Product: Phospho-PAK3 (Ser154) Antibody
Catalog: AF0046
Source: Rabbit
Application: WB, IHC, ELISA(peptide)
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 72kD; 62kD(Calculated).
Uniprot: O75914
RRID: AB_2834092

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human,Mouse,Rat
Prediction:
Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
Phospho-PAK3 (Ser154) Antibody detects endogenous levels of PAK3 only when phosphorylated at Sersine 154.
RRID:
AB_2834092
Cite Format: Affinity Biosciences Cat# AF0046, RRID:AB_2834092.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Alpha PAK; Beta PAK; bPAK; CDKN1A; Gamma PAK; hPAK3; MRX30; MRX47; Oligophrenin 3; OPHN3; P21 (CDKN1A) activated kinase 2; P21 (CDKN1A) activated kinase 3; p21 activated kinase 1; p21 activated kinase 2; p21 activated kinase 3; P21 protein (Cdc42/Rac) activated kinase 1; P21 protein (Cdc42/Rac) activated kinase 2; P21 protein (Cdc42/Rac) activated kinase 3; P21/Cdc42/Rac1 activated kinase 1 (STE20 homolog, yeast); P21/Cdc42/Rac1 activated kinase 1 (yeast Ste20 related); P58; P65 PAK; PAK 2; PAK 3; PAK1; PAK2; PAK3; PAK3beta; PAK65; PAKalpha; PAKgamma; S6/H4 kinase; Serine/threonine protein kinase PAK 1; Serine/threonine protein kinase PAK 2; Serine/threonine protein kinase PAK 3; Serine/threonine protein kinase PAK1; Serine/threonine protein kinase PAK2; Serine/threonine protein kinase PAK3; STE20 homolog, yeast;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
O75914 PAK3_HUMAN:

Restricted to the nervous system. Highly expressed in postmitotic neurons of the developing and postnatal cerebral cortex and hippocampus.

Description:
PAK3 a protein kinase of the STE20 family that regulates synapse formation and plasticity in the hippocampus. May be necessary for dendritic development and for the rapid cytoskeletal reorganization in dendritic spines associated with synaptic plasticity. Forms an activated complex with GTP-bound P21, CDC2 and RAC1 proteins. Missense and truncation mutations linked to nonsyndromic mental retardation type 30 (MRX30). Two alternatively spliced human isoforms have been reported. Note: This description may include information from UniProtKB.
Sequence:
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Chicken
100
Rabbit
100
Pig
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - O75914 As Substrate

Site PTM Type Enzyme
S2 Phosphorylation
S50 Phosphorylation
K58 Ubiquitination
T59 Phosphorylation
K62 Ubiquitination
K124 Ubiquitination
S154 Phosphorylation
S186 Phosphorylation
Y217 Phosphorylation
T218 Phosphorylation
S220 Phosphorylation
K257 Acetylation
S259 Phosphorylation
K269 Acetylation
S272 Phosphorylation
S275 Phosphorylation
Y298 Phosphorylation
K322 Ubiquitination
K404 Ubiquitination
T428 Phosphorylation
K433 Acetylation
K433 Ubiquitination
S435 Phosphorylation
T436 Phosphorylation
T440 Phosphorylation
Y477 Phosphorylation
S524 Phosphorylation
K526 Ubiquitination
K535 Acetylation
K535 Ubiquitination
S558 Phosphorylation

PTMs - O75914 As Enzyme

Substrate Site Source
O75914-2 (PAK3) S139 Uniprot
O75914-2 (PAK3) T421 Uniprot
P04049 (RAF1) S338 Uniprot
P04049 (RAF1) S339 Uniprot
P17600-1 (SYN1) S605 Uniprot
P19429 (TNNI3) S150 Uniprot
Q02750 (MAP2K1) S298 Uniprot
Q05682 (CALD1) S714 Uniprot
Q05682 (CALD1) S744 Uniprot
Q16659 (MAPK6) S189 Uniprot
Q9UM54-1 (MYO6) T405 Uniprot

Research Backgrounds

Function:

Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, or cell cycle regulation. Plays a role in dendrite spine morphogenesis as well as synapse formation and plasticity. Acts as downstream effector of the small GTPases CDC42 and RAC1. Activation by the binding of active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates MAPK4 and MAPK6 and activates the downstream target MAPKAPK5, a regulator of F-actin polymerization and cell migration. Additionally, phosphorylates TNNI3/troponin I to modulate calcium sensitivity and relaxation kinetics of thin myofilaments. May also be involved in early neuronal development.

PTMs:

Autophosphorylated when activated by CDC42/p21.

Neddylated.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Restricted to the nervous system. Highly expressed in postmitotic neurons of the developing and postnatal cerebral cortex and hippocampus.

Subunit Structure:

Interacts tightly with GTP-bound but not GDP-bound CDC42/p21 and RAC1. Shows highly specific binding to the SH3 domains of phospholipase C-gamma and of adapter protein NCK. Interacts with the C-terminal of APP (By similarity). Interacts with ARHGEF6 and ARHGEF7.

Family&Domains:

Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.   (View pathway)

· Environmental Information Processing > Signal transduction > ErbB signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Human Diseases > Cancers: Specific types > Renal cell carcinoma.   (View pathway)

· Organismal Systems > Development > Axon guidance.   (View pathway)

· Organismal Systems > Immune system > T cell receptor signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.