Product: Phospho-hnRPD (Ser83) Antibody
Catalog: AF0033
Source: Rabbit
Application: WB, IHC, IF/ICC, ELISA(peptide)
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 38kD; 38kD(Calculated).
Uniprot: Q14103
RRID: AB_2834084

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human,Mouse,Rat
Prediction:
Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
Phospho-hnRPD (Ser83) Antibody detects endogenous levels of hnRPD only when phosphorylated at Sersine 83.
RRID:
AB_2834084
Cite Format: Affinity Biosciences Cat# AF0033, RRID:AB_2834084.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ARE binding protein AUFI type A; AU-rich element RNA-binding protein 1; AUF; AUF1; AUF1A; Heterogeneous nuclear ribonucleoprotein D0; hnRNP D; hnRNP D0; Hnrnpd; hnRNPD0; HNRPD; HNRPD_HUMAN; P37;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. This protein is implicated in the regulation of mRNA stability. Alternative splicing of this gene results in four transcript variants.
Sequence:
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Pig
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q14103 As Substrate

Site PTM Type Enzyme
S2 Acetylation
S2 Phosphorylation
S71 Phosphorylation
K72 Acetylation
K72 Ubiquitination
S80 Phosphorylation
S82 Phosphorylation
S83 Phosphorylation P49841 (GSK3B)
S87 Phosphorylation P17612 (PRKACA)
T91 Phosphorylation
R94 Methylation
S105 Phosphorylation
K110 Acetylation
K110 Ubiquitination
K111 Acetylation
K111 Ubiquitination
K114 Acetylation
K114 Ubiquitination
K119 Acetylation
K119 Ubiquitination
C126 S-Nitrosylation
T127 Phosphorylation
K129 Acetylation
K129 Ubiquitination
T134 Phosphorylation
S137 Phosphorylation
R138 Methylation
K153 Acetylation
K153 Ubiquitination
K158 Acetylation
K165 Acetylation
K165 Ubiquitination
K183 Ubiquitination
S190 Phosphorylation
T193 Phosphorylation P24941 (CDK2)
K197 Acetylation
K197 Sumoylation
K197 Ubiquitination
Y201 Phosphorylation
S210 Phosphorylation
K218 Acetylation
K218 Methylation
K218 Ubiquitination
C226 S-Nitrosylation
K231 Acetylation
K231 Ubiquitination
K238 Acetylation
K243 Acetylation
K243 Ubiquitination
Y244 Phosphorylation
K251 Acetylation
K251 Ubiquitination
K255 Ubiquitination
K260 Methylation
K260 Ubiquitination
Y263 Phosphorylation
S271 Phosphorylation
R272 Methylation
R278 Methylation
R280 Methylation
R282 Methylation
R345 Methylation
S351 Phosphorylation
K353 Acetylation
K353 Methylation

Research Backgrounds

Function:

Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Also binds to double- and single-stranded DNA sequences in a specific manner and functions a transcription factor. Each of the RNA-binding domains specifically can bind solely to a single-stranded non-monotonous 5'-UUAG-3' sequence and also weaker to the single-stranded 5'-TTAGGG-3' telomeric DNA repeat. Binds RNA oligonucleotides with 5'-UUAGGG-3' repeats more tightly than the telomeric single-stranded DNA 5'-TTAGGG-3' repeats. Binding of RRM1 to DNA inhibits the formation of DNA quadruplex structure which may play a role in telomere elongation. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. May play a role in the regulation of the rhythmic expression of circadian clock core genes. Directly binds to the 3'UTR of CRY1 mRNA and induces CRY1 rhythmic translation. May also be involved in the regulation of PER2 translation.

PTMs:

Arg-345 is dimethylated, probably to asymmetric dimethylarginine.

Methylated by PRMT1, in an insulin-dependent manner. The PRMT1-mediated methylation regulates tyrosine phosphorylation (By similarity).

Subcellular Location:

Nucleus. Cytoplasm.
Note: Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Component of ribonucleosomes. Cytoplasmic localization oscillates diurnally.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Identified in a IGF2BP1-dependent mRNP granule complex containing untranslated mRNAs. Part of a complex associated with the FOS mCRD domain and consisting of PABPC1, PAIP1, CSDE1/UNR and SYNCRIP. Interacts with IGF2BP2. Interacts with GTPBP1. Interacts with EIF4G1; the interaction requires RNA. Interacts with EIF3B and RPS3.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.