Price Size
$280 100ul
$350 200ul

Same day delivery

Contact distributor
  • Product Name
    Phospho-CCR5 (Ser349) Antibody
  • Catalog No.
    AF0018
  • RRID
    AB_2834081
  • Source
    Rabbit
  • Application
    WB,IF/ICC,ELISA
  • Reactivity
    Human
  • UniProt
  • Mol.Wt
    40kD;
    41kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

AM4 7; C C chemokine receptor type 5; C C CKR 5; C-C chemokine receptor type 5; C-C CKR-5; C-C motif chemokine receptor 5 A159A; CC Chemokine Receptor 5; CC Chemokine Receptor Type 5; CC CKR 5; CC-CKR-5; CCCKR 5; CCCKR5; CCR 5; CCR-5; CCR5; CCR5 chemokine (C C motif) receptor 5; CCR5_HUMAN; CD 195; CD195; CD195 Antigen; Chemokine C C motif receptor 5; Chemokine receptor CCR5; CHEMR13; CKR 5; CKR5; CMKBR 5; CMKBR5; FLJ78003; HIV 1 Fusion Coreceptor; HIV-1 fusion coreceptor; HIV1 fusion coreceptor; IDDM22; MIP-1 alpha receptor;

Applications:

WB 1:500-1:2000, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Specificity:

Phospho-CCR5 (Ser349) Antibody detects endogenous levels of CCR5 only when phosphorylated at Sersine 349.

RRID:

AB_2834081
Please cite this product as: Affinity Biosciences Cat# AF0018, RRID:AB_2834081.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

A synthesized peptide derived from human CCR5 around the phosphorylation site of Ser349.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

CCR5

Molecular Weight:

Observed Mol.Wt.: 40kD.
Predicted Mol.Wt.: 41kDa(Calculated)..

Subcellular Location:

Cell membrane.

Tissue Specificity:

P51681 CCR5_HUMAN:
Highly expressed in spleen, thymus, in the myeloid cell line THP-1, in the promyeloblastic cell line KG-1a and on CD4+ and CD8+ T-cells. Medium levels in peripheral blood leukocytes and in small intestine. Low levels in ovary and lung.

Description:

CCR5 a 7-transmembrane G-linked receptor for a number of inflammatory C-C type chemokines including MIP-1-alpha, MIP-1-beta and RANTES. Transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Acts as a coreceptor (along with CD4) for HIV-1 R5 isolates. Interacts with PRAF2. Interacts with HIV-1 surface protein gp120. Efficient ligand binding to CCL3/MIP-1alpha and CCR4/MIP-1beta requires sulfation, O-glycosylation and sialic acid modifications. Glycosylation on S6 is required for efficient binding of CCL4.

Sequence:
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Research Background

Function:

Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation.

(Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) of human immunodeficiency virus-1/HIV-1.

Post-translational Modifications:

Sulfated on at least 2 of the N-terminal tyrosines. Sulfation contributes to the efficiency of HIV-1 entry and is required for efficient binding of the chemokines, CCL3 and CCL4.

O-glycosylated, but not N-glycosylated. Ser-6 appears to be the major site. Also sialylated glycans present which contribute to chemokine binding. Thr-16 and Ser-17 may also be glycosylated and, if so, with small moieties such as a T-antigen.

Palmitoylation in the C-terminal is important for cell surface expression, and to a lesser extent, for HIV entry.

Phosphorylation on serine residues in the C-terminal is stimulated by binding CC chemokines especially by APO-RANTES.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Highly expressed in spleen, thymus, in the myeloid cell line THP-1, in the promyeloblastic cell line KG-1a and on CD4+ and CD8+ T-cells. Medium levels in peripheral blood leukocytes and in small intestine. Low levels in ovary and lung.

Subunit Structure:

Interacts with PRAF2 (PubMed:15757671). Efficient ligand binding to CCL3/MIP-1alpha and CCL4/MIP-1beta requires sulfation, O-glycosylation and sialic acid modifications. Glycosylation on Ser-6 is required for efficient binding of CCL4 (PubMed:11733580, PubMed:8663314, PubMed:8699119, PubMed:10383387). Interacts with GRK2 (PubMed:10085131). Interacts with ARRB1 and ARRB2 (PubMed:11448957, PubMed:16144840). Interacts with CNIH4 (PubMed:24405750).

(Microbial infection) Interacts with HIV-1 surface protein gp120.

(Microbial infection) May interact with human cytomegalovirus/HHV-5 protein UL78.

Similarity:

Belongs to the G-protein coupled receptor 1 family.

Research Fields

Research Fields:

· Cellular Processes > Transport and catabolism > Endocytosis.(View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.(View pathway)
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
· Organismal Systems > Immune system > Chemokine signaling pathway.(View pathway)

WB Images(1)


IF/ICC Images(1)


ELISA analysis of AF0018 showing specificity to Phospho-CCR5 (Ser349) Blocking Peptide peptide. Peptides concentration: 1ug/ml.
P-peptide: phospho-peptide; N-peptide: non-phospho-peptide.
No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF0018-BP
(Blocking peptide available as AF0018-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Rabbit
75%
Zebrafish
0%
Chicken
0%
Xenopus
0%
Dog
0%
Horse
0%
Bovine
0%
Sheep
0%
Pig
0%
High similarity Medium similarity Low similarity No similarity
P51681 as Substrate
Site PTM Type Enzyme
S6 O-Glycosylation
S7 O-Glycosylation
T195 Phosphorylation
S336 Phosphorylation A0A024R1D8 (ADRBK2) , P35626 (GRK3)
S337 Phosphorylation P35626 (GRK3) , A0A024R1D8 (ADRBK2)
Y339 Phosphorylation
S342 Phosphorylation P35626 (GRK3) , A0A024R1D8 (ADRBK2)
T343 Phosphorylation
S349 Phosphorylation A0A024R1D8 (ADRBK2) , P35626 (GRK3)
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top