FGFR1 Oncogene Partner Antibody - #AF0158
Product: | FGFR1 Oncogene Partner Antibody |
Catalog: | AF0158 |
Description: | Rabbit polyclonal antibody to FGFR1 Oncogene Partner |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Rabbit, Dog |
Mol.Wt.: | 43kDa; 43kD(Calculated). |
Uniprot: | O95684 |
RRID: | AB_2833339 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0158, RRID:AB_2833339.
Fold/Unfold
FGFR1 oncogene partner; FGFR1OP; Fibroblast growth factor receptor 1 oncogene partner; FOP; FR1OP_HUMAN; OTTHUMP00000017612; OTTHUMP00000017613;
Immunogens
Ubiquitous. Highly expressed in heart, liver, muscle, kidney, intestine, colon, adrenal gland, prostate, testis, and pancreas.
- O95684 FR1OP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95684 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T4 | Phosphorylation | Uniprot | |
T55 | Phosphorylation | Uniprot | |
S61 | Phosphorylation | Uniprot | |
K63 | Ubiquitination | Uniprot | |
T143 | Phosphorylation | Uniprot | |
S152 | Phosphorylation | Uniprot | |
S156 | Phosphorylation | Uniprot | |
S160 | Phosphorylation | Uniprot | |
T165 | Phosphorylation | Uniprot | |
T169 | Phosphorylation | Uniprot | |
T170 | Phosphorylation | Uniprot | |
S172 | Phosphorylation | Uniprot | |
K182 | Acetylation | Uniprot | |
K183 | Acetylation | Uniprot | |
K184 | Acetylation | Uniprot | |
S202 | Phosphorylation | Uniprot | |
T204 | Phosphorylation | Uniprot | |
S209 | Phosphorylation | Uniprot | |
K214 | Acetylation | Uniprot | |
S228 | Phosphorylation | Uniprot | |
S231 | Phosphorylation | Uniprot | |
T234 | Phosphorylation | Uniprot | |
S254 | Phosphorylation | Uniprot | |
T266 | Phosphorylation | Uniprot | |
Y267 | Phosphorylation | Uniprot | |
S279 | Phosphorylation | Uniprot | |
S291 | Phosphorylation | Uniprot | |
S301 | Phosphorylation | Uniprot | |
K323 | Ubiquitination | Uniprot | |
S326 | Phosphorylation | Uniprot | |
Y337 | Phosphorylation | Uniprot | |
S343 | Phosphorylation | Uniprot | |
S348 | Phosphorylation | Uniprot | |
S389 | Phosphorylation | Uniprot | |
Y394 | Phosphorylation | Uniprot |
Research Backgrounds
Required for anchoring microtubules to the centrosomes. Required for ciliation.
Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome>Centriole. Cytoplasm>Cytoskeleton>Cilium basal body.
Note: Associated with gamma-tubulin (PubMed:16314388). Localizes on both mother and daughter centrioles (PubMed:28625565, PubMed:28428259). Localizes to an axial position on the mother centriole (PubMed:28625565). Localizes to the distal end of the centriole partly on the subdistal appendage region (PubMed:28659385).
Ubiquitous. Highly expressed in heart, liver, muscle, kidney, intestine, colon, adrenal gland, prostate, testis, and pancreas.
Homodimer. Part of a ternary complex that contains CEP350, FGFR1OP and MAPRE1. Interacts directly with CEP350 and MAPRE1. Interacts with CEP19. Interacts (via N-terminus) with CEP350 (via C-terminus).
Belongs to the FGFR1OP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.