Price Size
$250 50ul
$350 100ul
$450 200ul

Ship 3-4 business days

Contact distributor
  • Product Name
    PRKACG Antibody
  • Catalog No.
    BF0052
  • RRID
    AB_2834016
  • Source
    Mouse
  • Application
    WB,IHC,ELISA,FCM
  • Reactivity
    Human
  • UniProt
  • Mol.Wt
    40.4kD;
    40kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Product Information

Alternative Names:Expand▼

cAMP-dependent protein kinase catalytic subunit gamma; KAPCG_HUMAN; KAPG; PKA C gamma; PKA C-gamma; PKACg; PRKACG; Protein kinase cAMP dependent catalytic gamma; Serine (threonine) protein kinase;

Applications:

ELISA 1:10000, WB 1:500-1:2000, IHC 1:200-1:1000, FCM 1:200-1:400
*The optimal dilutions should be determined by the end user.

Reactivity:

Human

Source:

Mouse

Clonality:

Monoclonal

Clone Number:

AFB1994

Purification:

Affinity-chromatography.

Specificity:

PRKACG antibody detects endogenous levels of total PRKACG.

RRID:

AB_2834016
Please cite this product as: Affinity Biosciences Cat# BF0052, RRID:AB_2834016.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

Purified recombinant fragment of human PRKACG expressed in E. Coli.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

PRKACG

Molecular Weight:

Observed Mol.Wt.: 40.4kD.
Predicted Mol.Wt.: 40kDa(Calculated)..

Tissue Specificity:

P22612 KAPCG_HUMAN:
Testis specific. But important tissues such as brain and ovary have not been analyzed for the content of transcript.

Description:

Cyclic AMP-dependent protein kinase (PKA) consists of two catalytic subunits and a regulatory subunit dimer. This gene encodes the gamma form of its catalytic subunit.

Sequence:
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF

Research Background

Function:

Phosphorylates a large number of substrates in the cytoplasm and the nucleus.

Tissue Specificity:

Testis specific. But important tissues such as brain and ovary have not been analyzed for the content of transcript.

Subunit Structure:

A number of inactive tetrameric holoenzymes are produced by the combination of homo- or heterodimers of the different regulatory subunits associated with two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits.

Similarity:

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.

Research Fields

Research Fields:

· Cellular Processes > Cellular community - eukaryotes > Tight junction.(View pathway)
· Cellular Processes > Cell growth and death > Oocyte meiosis.(View pathway)
· Cellular Processes > Cellular community - eukaryotes > Gap junction.(View pathway)
· Cellular Processes > Transport and catabolism > Autophagy - animal.(View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Wnt signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Calcium signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Apelin signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Hedgehog signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > cAMP signaling pathway.(View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer.(View pathway)
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Human Diseases > Substance dependence > Amphetamine addiction.
· Human Diseases > Cardiovascular diseases > Dilated cardiomyopathy (DCM).
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
· Human Diseases > Infectious diseases: Bacterial > Vibrio cholerae infection.
· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Substance dependence > Morphine addiction.
· Human Diseases > Substance dependence > Cocaine addiction.
· Human Diseases > Neurodegenerative diseases > Prion diseases.
· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.
· Organismal Systems > Immune system > Platelet activation.(View pathway)
· Organismal Systems > Endocrine system > Ovarian steroidogenesis.
· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.
· Organismal Systems > Endocrine system > Insulin secretion.(View pathway)
· Organismal Systems > Endocrine system > Thyroid hormone synthesis.
· Organismal Systems > Digestive system > Salivary secretion.
· Organismal Systems > Digestive system > Gastric acid secretion.
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Renin secretion.
· Organismal Systems > Excretory system > Endocrine and other factor-regulated calcium reabsorption.
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.(View pathway)
· Organismal Systems > Endocrine system > Insulin signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Regulation of lipolysis in adipocytes.
· Organismal Systems > Nervous system > Long-term potentiation.
· Organismal Systems > Endocrine system > Glucagon signaling pathway.
· Organismal Systems > Nervous system > Dopaminergic synapse.
· Organismal Systems > Sensory system > Taste transduction.
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.(View pathway)
· Organismal Systems > Excretory system > Vasopressin-regulated water reabsorption.
· Organismal Systems > Endocrine system > Oxytocin signaling pathway.
· Organismal Systems > Nervous system > GABAergic synapse.
· Organismal Systems > Nervous system > Glutamatergic synapse.
· Organismal Systems > Aging > Longevity regulating pathway.(View pathway)
· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels.(View pathway)
· Organismal Systems > Sensory system > Olfactory transduction.
· Organismal Systems > Nervous system > Cholinergic synapse.
· Organismal Systems > Aging > Longevity regulating pathway - multiple species.(View pathway)
· Organismal Systems > Environmental adaptation > Circadian entrainment.
· Organismal Systems > Endocrine system > Melanogenesis.
· Organismal Systems > Immune system > Chemokine signaling pathway.(View pathway)
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling.(View pathway)
· Organismal Systems > Nervous system > Serotonergic synapse.
· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.
· Organismal Systems > Endocrine system > Estrogen signaling pathway.(View pathway)

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

BF0052-BP
(Blocking peptide available as BF0052-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

P22612 as Substrate
Site PTM Type Enzyme
Y118 Phosphorylation
Y123 Phosphorylation
R132 Methylation
T196 Phosphorylation
T198 Phosphorylation
T202 Phosphorylation
K214 Ubiquitination
K310 Ubiquitination
P22612 as PTM Enzyme
Substrate Site Source
P29474 (NOS3) S1177 Uniprot
Q13185 (CBX3) S93 Uniprot
Q14896 (MYBPC3) S275 Uniprot
Q14896 (MYBPC3) S284 Uniprot
Q14896 (MYBPC3) S304 Uniprot
Q14896 (MYBPC3) S311 Uniprot
Q92934 (BAD) S75 Uniprot
Q92934 (BAD) S99 Uniprot
Q92934 (BAD) S118 Uniprot
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top