HES5 Antibody - #DF2407
| Product: | HES5 Antibody |
| Catalog: | DF2407 |
| Description: | Rabbit polyclonal antibody to HES5 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Dog, Chicken |
| Mol.Wt.: | 18 kD; 18kD(Calculated). |
| Uniprot: | Q5TA89 |
| RRID: | AB_2839614 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2407, RRID:AB_2839614.
Fold/Unfold
bHLHb38; Class B basic helix-loop-helix protein 38; Hairy and enhancer of split 5; Hairy/Enhancer of spli, Drosophila, homolog of, 5; HES 5; hes family bHLH transcription factor 5; Hes5; HES5 protein; HES5_HUMAN; MGI:104876; Transcription factor HES-5;
Immunogens
- Q5TA89 HES5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q5TA89 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S4 | Phosphorylation | Uniprot | |
| T5 | Phosphorylation | Uniprot | |
| S12 | Phosphorylation | Uniprot | |
| S72 | Phosphorylation | Uniprot | |
| K73 | Acetylation | Uniprot | |
| K82 | Acetylation | Uniprot | |
| K134 | Ubiquitination | Uniprot |
Research Backgrounds
Transcriptional repressor of genes that require a bHLH protein for their transcription. Plays an important role as neurogenesis negative regulator (By similarity).
Nucleus.
Expressed in fetal heart and brain tumors.
Transcription repression requires formation of a complex with a corepressor protein of the Groucho/TLE family.
Has a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG).
The C-terminal WRPW motif is a transcriptional repression domain necessary for the interaction with Groucho/TLE family members, transcriptional corepressors recruited to specific target DNA by Hairy-related proteins.
Research Fields
· Environmental Information Processing > Signal transduction > Notch signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Breast cancer. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.