Product: LAMP3 Antibody
Catalog: DF7099
Description: Rabbit polyclonal antibody to LAMP3
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 44kDa; 44kD(Calculated).
Uniprot: Q9UQV4
RRID: AB_2839054

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:100, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
LAMP3 Antibody detects endogenous levels of total LAMP3.
RRID:
AB_2839054
Cite Format: Affinity Biosciences Cat# DF7099, RRID:AB_2839054.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD208; CD208 antigen; DC LAMP; DC lysosome associated membrane glycoprotein; DC-lysosome-associated membrane glycoprotein; DCLAMP; LAMP; LAMP 3; LAMP-3; Lamp3; LAMP3_HUMAN; Lysosomal associated membrane protein 3; Lysosomal-associated membrane protein 3; Lysosome-associated membrane glycoprotein 3; Protein TSC403; TSC403;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q9UQV4 LAMP3_HUMAN:

Detected in tonsil interdigitating dendritic cells, in spleen, lymph node, Peyer's patches in the small instestine, in thymus medulla and in B-cells (at protein level). Expressed in lymphoid organs and dendritic cells. Expressed in lung. Up-regulated in carcinomas of the esophagus, colon, rectum, ureter, stomach, breast, fallopian tube, thyroid and parotid tissues.

Description:
Lysosome-associated membrane glycoprotein 3 is a protein that in humans is encoded by the LAMP3 gene. LAMP3 has also recently been designated CD208. Dendritic cells (DCs) are the most potent antigen-presenting cells. Immature DCs efficiently capture antigens and differentiate into interdigitating dendritic cells (IDCs) in lymphoid tissues that induce primary T-cell responses .May play a role in dendritic cell function and in adaptive immunity.
Sequence:
MPRQLSAAAALFASLAVILHDGSQMRAKAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI

PTMs - Q9UQV4 As Substrate

Site PTM Type Enzyme
S23 Phosphorylation
S37 O-Glycosylation
T40 O-Glycosylation
T44 O-Glycosylation
T74 O-Glycosylation
T77 O-Glycosylation
T80 O-Glycosylation
S234 Phosphorylation
Y260 Phosphorylation
T268 Phosphorylation
S271 Phosphorylation
T276 Phosphorylation
N291 N-Glycosylation
Y413 Phosphorylation

Research Backgrounds

Function:

May play a role in dendritic cell function and in adaptive immunity.

Subcellular Location:

Lysosome membrane>Single-pass type I membrane protein. Cytoplasmic vesicle membrane>Single-pass type I membrane protein.
Note: During dendritic cell maturation, detected on cytoplasmic vesicles (the MHC II compartment) that contain MHC II proteins, LAMP1, LAMP2 and LAMP3 (PubMed:9768752). Detected on lysosomes in mature dendritic cells (PubMed:9768752).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in tonsil interdigitating dendritic cells, in spleen, lymph node, Peyer's patches in the small instestine, in thymus medulla and in B-cells (at protein level). Expressed in lymphoid organs and dendritic cells. Expressed in lung. Up-regulated in carcinomas of the esophagus, colon, rectum, ureter, stomach, breast, fallopian tube, thyroid and parotid tissues.

Subunit Structure:

Monomer.

Family&Domains:

Belongs to the LAMP family.

Research Fields

· Cellular Processes > Transport and catabolism > Lysosome.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.