c-Fos Antibody - #AF0132

(13)   (12)  
Product: c-Fos Antibody
Catalog: AF0132
Description: Rabbit polyclonal antibody to c-Fos
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 50kDa; 41kD(Calculated).
Uniprot: P01100
RRID: AB_2833316

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(80%)
Clonality:
Polyclonal
Specificity:
c-Fos Antibody detects endogenous levels of total c-Fos.
RRID:
AB_2833316
Cite Format: Affinity Biosciences Cat# AF0132, RRID:AB_2833316.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Activator protein 1; AP 1; C FOS; Cellular oncogene c fos; Cellular oncogene fos; FBJ murine osteosarcoma viral (v fos) oncogene homolog (oncogene FOS); FBJ murine osteosarcoma viral oncogene homolog; FBJ murine osteosarcoma viral v fos oncogene homolog; FBJ Osteosarcoma Virus; FOS; FOS protein; FOS_HUMAN; G0 G1 switch regulatory protein 7; G0/G1 switch regulatory protein 7; G0S7; Oncogene FOS; p55; proto oncogene c Fos; Proto oncogene protein c fos; Proto-oncogene c-Fos; v fos FBJ murine osteosarcoma viral oncogene homolog;

Immunogens

Immunogen:
Uniprot:

P01100(FOS_HUMAN) >>Visit HPA database.

Gene(ID):
FOS(2353)
Description:
Fos a proto-oncogenic transcription factor of the bZIP family. Dimerizes with proteins of the JUN family, thereby forming the transcription factor complex AP-1. FOS proteins function as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of FOS has also been associated with apoptotic cell death. Expression increases upon a variety of stimuli, including growth factors, cytokines, neurotransmitters, polypeptide hormones, stress and cell injury.
Sequence:
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Dog
100
Chicken
100
Rabbit
100
Xenopus
80
Sheep
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P01100 As Substrate

Site PTM Type Enzyme
Y10 Phosphorylation
Y30 Phosphorylation
S32 Phosphorylation Q13164 (MAPK7)
S70 Phosphorylation
K113 Sumoylation
K113 Ubiquitination
T114 Phosphorylation
T116 Phosphorylation
K128 Sumoylation
S133 Phosphorylation
K139 Sumoylation
K176 Sumoylation
K188 Ubiquitination
T232 Phosphorylation Q13164 (MAPK7) , P27361 (MAPK3) , P28482 (MAPK1)
S258 Phosphorylation
S261 Phosphorylation
K265 Sumoylation
S278 Phosphorylation
S308 Phosphorylation O14920 (IKBKB)
T325 Phosphorylation P27361 (MAPK3) , P28482 (MAPK1)
T331 Phosphorylation P28482 (MAPK1) , P27361 (MAPK3)
S362 Phosphorylation O75676 (RPS6KA4) , Q15418 (RPS6KA1)
S363 Phosphorylation
S374 Phosphorylation P28482 (MAPK1) , P27361 (MAPK3)
T376 Phosphorylation

Research Backgrounds

Function:

Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum.

PTMs:

Phosphorylated in the C-terminal upon stimulation by nerve growth factor (NGF) and epidermal growth factor (EGF). Phosphorylated, in vitro, by MAPK and RSK1. Phosphorylation on both Ser-362 and Ser-374 by MAPK1/2 and RSK1/2 leads to protein stabilization with phosphorylation on Ser-374 being the major site for protein stabilization on NGF stimulation. Phosphorylation on Ser-362 and Ser-374 primes further phosphorylations on Thr-325 and Thr-331 through promoting docking of MAPK to the DEF domain. Phosphorylation on Thr-232, induced by HA-RAS, activates the transcriptional activity and antagonizes sumoylation. Phosphorylation on Ser-362 by RSK2 in osteoblasts contributes to osteoblast transformation (By similarity).

Constitutively sumoylated with SUMO1, SUMO2 and SUMO3. Desumoylated by SENP2. Sumoylation requires heterodimerization with JUN and is enhanced by mitogen stimulation. Sumoylation inhibits the AP-1 transcriptional activity and is, itself, inhibited by Ras-activated phosphorylation on Thr-232.

In quiescent cells, the small amount of FOS present is phosphorylated at Tyr-10 and Tyr-30 by SRC. This Tyr-phosphorylated form is cytosolic. In growing cells, dephosphorylated by PTPN2. Dephosphorylation leads to the association with endoplasmic reticulum membranes and activation of phospholipid synthesis.

Subcellular Location:

Nucleus. Endoplasmic reticulum. Cytoplasm>Cytosol.
Note: In quiescent cells, present in very small amounts in the cytosol. Following induction of cell growth, first localizes to the endoplasmic reticulum and only later to the nucleus. Localization at the endoplasmic reticulum requires dephosphorylation at Tyr-10 and Tyr-30.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Heterodimer; with JUN (By similarity). Interacts with MAFB (By similarity). Component of the SMAD3/SMAD4/JUN/FOS complex required for synergistic TGF-beta-mediated transcription at the AP1 promoter site. Interacts with SMAD3; the interaction is weak even on TGF-beta activation. Interacts with MAFB. Interacts with DSIPI; this interaction inhibits the binding of active AP1 to its target DNA. Interacts with CDS1 and PI4K2A (By similarity).

Family&Domains:

Belongs to the bZIP family. Fos subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cAMP signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

· Human Diseases > Substance dependence > Amphetamine addiction.

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Colorectal cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Choline metabolism in cancer.   (View pathway)

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Development > Osteoclast differentiation.   (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Th1 and Th2 cell differentiation.   (View pathway)

· Organismal Systems > Immune system > Th17 cell differentiation.   (View pathway)

· Organismal Systems > Immune system > T cell receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > B cell receptor signaling pathway.   (View pathway)

· Organismal Systems > Environmental adaptation > Circadian entrainment.

· Organismal Systems > Nervous system > Cholinergic synapse.

· Organismal Systems > Nervous system > Dopaminergic synapse.

· Organismal Systems > Endocrine system > Estrogen signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Prolactin signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Oxytocin signaling pathway.

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

References

1). Macrophage biomimetic nanoparticle-targeted functional extracellular vesicle micro-RNAs revealed via multiomics analysis alleviate sepsis-induced acute lung injury. Journal of nanobiotechnology, 2024 (PubMed: 38910259) [IF=10.2]
2). Diterbutyl phthalate attenuates osteoarthritis in ACLT mice via suppressing ERK/c-fos/NFATc1 pathway, and subsequently inhibiting subchondral osteoclast fusion. ACTA PHARMACOLOGICA SINICA, 2022 (PubMed: 34381182) [IF=8.2]
3). Guanxinning injection ameliorates cardiac remodeling in HF mouse and 3D heart spheroid models via p38/FOS/MMP1-mediated inhibition of myocardial hypertrophy and fibrosis. Biomedicine & Pharmacotherapy, 2023 (PubMed: 37027988) [IF=7.5]

Application: WB    Species: Mouse    Sample:

FIGURE 2 PTS reduces reduction of NLRP3 inflammasome and apoptosis in DOX-treated mice. (A) WT C57/BL6J mice were pretreated with PTS (10 mg/kg) and afterwards with DOX (20 mg/kg cumulative dose) for 6 days. Immunochemistry staining of the liver sections with anti-NLRP3 (left, scale bar = 50 μm), the quantification of NLRP3 positive area in each group (right, n = 6); (B) qPCR analyses of NLRP3, IL-1β and IL-18 mRNA levels in each group (n = 6); (C) Western blot analyses of NLRP3, ASC, Caspase-1 p20, IL-1β, and IL-18 proteins and the quantification of the blots in each group (n = 4 per group); (D) Western blot analyses of Cleaved Caspase-3, BAX, and BCL-2 proteins (left) and quantification of the blots in each group (right, n = 4 per group).
4). β-Conglycinin-Induced Intestinal Porcine Epithelial Cell Damage via the Nuclear Factor κB/Mitogen-Activated Protein Kinase Signaling Pathway. Journal of agricultural and food chemistry, 2019 (PubMed: 31319030) [IF=6.1]
5). JNK signaling pathway mediates acetaminophen-induced hepatotoxicity accompanied by changes of glutathione S-transferase A1 content and expression. Frontiers in Pharmacology, 2019 (PubMed: 31620005) [IF=5.6]

Application: WB    Species: mouse    Sample: liver

FIGURE 2 | Activation of JNK signaling pathway under different dosages of APAP. (A) Western blot analyses of total tissue lysate for p-JNK, JNK, p-c-Jun, c-Jun,p-c-Fos, c-Fos, and β-actin (loading control).
6). Neurobehavioral alternations of the female offspring born to polycystic ovary syndrome model rats administered by Chinese herbal medicine. Chinese Medicine, 2021 (PubMed: 34600579) [IF=4.9]

Application: IF/ICC    Species: Human    Sample: ovarian granulosa cells

Fig. 5 Visualization of FOS expressed in the ovarian granulosa cells of the PCOS, BSTJF and control groups by double-labeling immunofluorescence with FoxL2 (winged helix forkhead transcription factor gene2, specific expression in adult ovarian granulosa cells) (green) and FOS (red). Nuclei were counterstained with 40,6-diamidino-2-phenylindole (DAPI) (blue fluorescence). All scale bars are 100 μm. The expression ratio of the target protein is shown by bar plots (n = 4 in each group). Data were presented as the mean ± SEM. One-way ANOVA for multiple comparisons and LSD test for pairwise comparisons between groups (*P < 0.05, #P < 0.01)

Application: IF/ICC    Species: rat    Sample: ovarian granulosa cells

Fig. 5| Visualization of FOS expressed in the ovarian granulosa cells of the PCOS, BSTJF and control groups by double-labeling immunofuorescence with FoxL2 (winged helix forkhead transcription factor gene2, specifc expression in adult ovarian granulosa cells) (green) and FOS (red). Nuclei were counterstained with 40,6-diamidino-2-phenylindole (DAPI) (blue fuorescence). All scale bars are 100 μm. The expression ratio of the target protein is shown by bar plots (n=4 in each group).
7). Schistosoma japonicum cystatin suppresses osteoclastogenesis via manipulating the NF‑κB signaling pathway. Molecular Medicine Reports, 2021 (PubMed: 33576450) [IF=3.4]

Application: WB    Species:    Sample: RAW264.7 cells

Figure 5.| rSj‑Cys represses M‑CSF and RANKL‑induced NF‑κB signaling during early phase osteoclastogenesis. RAW264.7 cells were co‑stimulated with M‑CSF (25 ng/ml) and RANKL (30 ng/ml) and then treated with or without rSj‑Cys (0.3 µM) for different time periods (4 or 24 h). The mRNA and protein expression levels of NF‑κB‑associated signaling molecules IκBα and p65, and of downstream targets NFATc1 and c‑Fos, were assessed by (A) reverse transcription‑quantitative PCR and (B) western blot analysis.

Application: WB    Species: Mice    Sample: RAW264.7 cells

Figure 5. rSj-Cys represses M-CSF and RANKL-induced NF-κB signaling during early-phase osteoclastogenesis. RAW264.7 cells were co-stimulated with M-CSF (25 ng/ml) and RANKL (30 ng/ml) and then treated with or without rSj-Cys (0.3 µM) for different time periods (4 or 24 h). The mRNA and protein expression levels of NF-κB-associated signaling molecules IκBα and p65, and of downstream targets NFATc1 and c-Fos, were assessed by (A) reverse transcription-quantitative PCR and (B) western blot analysis. Band intensity was semi-quantified using the ImageJ software and normalized against β-actin levels. Data are presented as mean ± SD of three independent experiments. ##P<0.01, ###P<0.001 vs. M-CSF alone group; **P<0.01, ***P<0.001 vs. M-CSF + RANKL group. rSj-Cys, recombinant Schistosoma japonicum cystatins; M-CSF, macrophage colony-stimulating factor; RANKL, receptor activator of NF-κB ligand; IκBα, NF-κB inhibitor α; p65, RELA proto-oncogene NF-κB subunit; NFATc1, nuclear factor of activated T-cells cytoplasmic 1; c-Fos, Fos proto-oncogene AP-1 transcription factor subunit.
8). Antinociceptive effects of IL-6R vs. glucocorticoid receptors during rat hind paw inflammatory pain. NEUROSCIENCE LETTERS, 2020 (PubMed: 32898615) [IF=2.5]

Application: WB    Species: rat    Sample: spinal cord

Fig. 5. |Role of anti-IL-6R, sgp130, and Dexamethasone in activated neurons, astrocytes, and microglia in the dorsal horn of FCA-treated rats vs. controls.G–J: Similar changes were noted in the expression of c-fos, GFAP, and Iba-1 proteins in the spinal cord (P < 0.05). *represents significant changes as compared to the control group. #represents significant changes as compared to the FCA group; bar = 40 μm.

Application: IF/ICC    Species: rat    Sample: activated neurons, astrocytes, and microglia

Fig. 5. |Role of anti-IL-6R, sgp130, and Dexamethasone in activated neurons, astrocytes, and microglia in the dorsal horn of FCA-treated rats vs. controls.A–F: The number of activated neurons, astrocytes, and microglia cells expressed by c-fos, GFAP, Iba-1 in the spinal dorsal horn was significantly enhanced in those rats receiving FCA intraplantar injection (P < 0.05), which were significantly decreased with anti-IL-6R, sgp130, and Dexa treatment (P < 0.05).
9). Resveratrol inhibits cell apoptosis by suppressing long noncoding RNA (lncRNA) XLOC_014869 during lipopolysaccharide-induced acute lung injury in rats. Journal of Thoracic Disease, 2021 (PubMed: 34992821) [IF=2.5]

Application: WB    Species: Rat    Sample: lung tissue

Figure 7 Verification of differential mRNA and lncRNA expression levels and analysis of cell apoptosis in rat lung tissue. Quantitative real-time PCR (A-F), and western blotting (G), and TUNEL (H) results of lung tissue in each group. Apoptotic cells were visualized at ×20 magnification. *, P
10). Prevention of acetaminophen-induced hepatocyte injury: JNK inhibition and GSTA1 involvement. Molecular & Cellular Toxicology, 2021 [IF=1.7]
Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.