Prolactin/PRL Antibody - #DF6506

(10)   (6)  
Product: Prolactin/PRL Antibody
Catalog: DF6506
Description: Rabbit polyclonal antibody to Prolactin/PRL
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 26kDa; 26kD(Calculated).
Uniprot: P01236
RRID: AB_2838468

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(92%), Bovine(92%), Horse(92%), Sheep(92%), Rabbit(92%), Dog(92%), Chicken(92%)
Clonality:
Polyclonal
Specificity:
Prolactin/PRL Antibody detects endogenous levels of total Prolactin/PRL.
RRID:
AB_2838468
Cite Format: Affinity Biosciences Cat# DF6506, RRID:AB_2838468.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Decidual prolactin; GHA1; Growth hormone A1; Lactogenic hormone; Luteotropic hormone; Mammotropin; PRL; Prolactin; Prolactin precursor;

Immunogens

Immunogen:
Uniprot:

P01236(PRL_HUMAN) >>Visit HPA database.

Gene(ID):
PRL(5617)
Description:
This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2011]
Sequence:
MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
92
Horse
92
Bovine
92
Sheep
92
Dog
92
Chicken
92
Rabbit
92
Zebrafish
64
Xenopus
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P01236 As Substrate

Site PTM Type Enzyme
S163 Phosphorylation
S179 Phosphorylation Q13177 (PAK2)
S194 Phosphorylation
S207 Phosphorylation Q13177 (PAK2)

Research Backgrounds

Function:

Prolactin acts primarily on the mammary gland by promoting lactation.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with PRLR.

Family&Domains:

Belongs to the somatotropin/prolactin family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Prolactin signaling pathway.   (View pathway)

References

1). Loss of miR-29a impairs decidualization of endometrial stromal cells by TET3 mediated demethylation of Col1A1 promoter. iScience (PubMed: 34568789) [IF=5.8]

Application: WB    Species: Human    Sample: ESCs

Figure 1 Inhibition of miR-29a attenuated proliferation and decidualization of the human ESCs (A) The expression status of miR-29a in different stages of endometrial tissues and decidual tissues. qRT-PCR analysis of miR-29a on endometrial tissues and decidual tissues. All results were relative to endometrial tissues of proliferative phase, and U6 served as an internal control. (B) Immunofluorescence for Vimentin in human ESCs showing cellular localization. Scale bar: 50 μm. (C) Phase contrast images of human ESCs. Scale bar: 100 μm. (D) qRT-PCR analysis of miR-29a levels in decidualized ESCs transfected with Control/miR-29a antagomir relative to control. U6 served as an internal control. (E–G) (E) CCK-8 assays were performed to evaluate decidualized ESCs viability transfected with Control/miR-29a antagomirfor 48h. Western blot analysis (F) and quantification (G) of PRL and IGFBP1 in decidualized ESCs transfected with Control/miR-29a antagomir (n = 3). Data are represented as mean ± SEM. An unpaired two-tailed Student's t-test was used for conducting direct comparison between two groups. Student's t test: n.s. = not significant, ∗p < 0.05, ∗∗p < 0.01.
2). Total Barley Maiya Alkaloids Prevent Increased Prolactin Levels Caused by Antipsychotic Drugs and Reduce Dopamine Receptor D2 via Epigenetic Mechanisms. Frontiers in Pharmacology (PubMed: 35865960) [IF=5.6]

Application: WB    Species: Rat    Sample:

FIGURE 3 Effects of TBMA, hordenine, and N-methyltyramine on PRL expression. (A,B) PRL protein expression determined by western blotting using GAPDH as a loading control. Data are presented as the mean ± SD (n = 3 rats per group). (C) PRL concentrations detected by ELIA (n = 8). (D) PRL mRNA expression. mRNA expression was determined using RT-PCR (n = 3 rats per group; # p < 0.05 and ## p < 0.01 versus the control group; * p < 0.05 and ** p < 0.01 versus the Ris group. Bro = bromocriptine; Hor = hordenine; N-Methy = N-methyltyramine; Ris = risperidone; TBMA = total barley maiya alkaloids.
3). Total barley maiya alkaloids inhibit prolactin secretion by acting on dopamine D2 receptor and protein kinase A targets. JOURNAL OF ETHNOPHARMACOLOGY (PubMed: 33711439) [IF=5.4]

Application: WB    Species: Rat    Sample: MMQ cells

Fig. 3. Effects of TBMA on PRL in MMQ cells and GH3 cells. (A) Effects of bromocriptine on PRL protein expression in MMQ cells and GH3 cells (n = 3). (B, C) Effects of TBMA on PRL in the supernatant of MMQ cells and GH3 cells detected by ELISA (n = 6). (D, E) Effects of TBMA on PRL protein in MMQ cells and GH3 cells detected by Western Blot (n = 3). Data were expressed as mean ± SD; compared with control group, **P < 0.01, *P < 0.05. TBMA = total barley maiya alkaloids; Bro = bromocriptine.
4). PBK/TOPK Inhibitor Suppresses the Progression of Prolactinomas. Frontiers in Endocrinology (PubMed: 35126305) [IF=5.2]

Application: WB    Species: Mice    Sample: pituitary tumor cells

Figure 2 HI-TOPK-032 reduced PRL production in pituitary tumor cells and it worked by mediating p38 MAPK signaling pathway. (A) HI-TOPK-032 decreased PRL protein expression in pituitary tumor cells detected by Western Blot assay. (B) HI-TOPK-032 decreased PRL mRNA expression in pituitary tumor cells detected by qRT-PCR assay. (C) HI-TOPK-032 decreased PRL secretion in cell supernatant detected by Elisa assay. (D) The expressions of TOPK, p38 MAPK and its phosphorylation level in pituitary tumor cells after HI-TOPK-032 intervention were detected by Western Blot assay. (E) HI-TOPK-032 reduced the phosphorylation of TOPK. (F) HI-TOPK-032 reduced the phosphorylation of p38 MAPK. *P < 0.05; **P < 0.01; ***P < 0.001; ****P < 0.0001.
5). Microglial NLRP3 inflammasome activation promotes prolactinomas development. ENDOCRINE-RELATED CANCER (PubMed: 33974557) [IF=3.9]
6). TLR4 inhibition suppresses growth in oestrogen-induced prolactinoma models. Endocrine-Related Cancer (PubMed: 36219868) [IF=3.9]
7). Inhibiting MAPK14 showed anti-prolactinoma effect. BMC Endocrine Disorders (PubMed: 32894113) [IF=2.7]
8). Mechanism of barley malt-dependent DRD2 to treat hyperprolactinemia based on UPLC-Q-TOF/MS and network pharmacology. European Journal of Integrative Medicine [IF=2.5]
9). Antiprolactinoma Effect of Hordenine by Inhibiting MAPK Signaling Pathway Activation in Rats. Evidence-based Complementary and Alternative Medicine (PubMed: 32382283)

Application: WB    Species: rat    Sample: pituitary gland

Figure 5: |Western blot image of pituitary gland protein expressions in rats. Control: control group, Sham: sham-operated control group,Model: model control group, Bro: bromocriptine group, Hor: hordenine group.
10). Loss of miR-29a Impairs Decidualisation of Endometrial Stromal Cells by Enhancing TET3 Binding to the Col1A1 Promoter.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.