Price Size
$280 100ul
$350 200ul

Same day delivery

Contact distributor
  • Product Name
    BDNF Antibody
  • Catalog No.
    DF6387
  • RRID
    AB_2838350
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
  • UniProt
  • Mol.Wt
    28kD;
    28kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

Abrineurin; ANON2; BDNF; BDNF_HUMAN; Brain Derived Neurotrophic Factor; Brain-derived neurotrophic factor; BULN2; MGC34632; Neurotrophin;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

BDNF Antibody detects endogenous levels of total BDNF.

RRID:

AB_2838350
Please cite this product as: Affinity Biosciences Cat# DF6387, RRID:AB_2838350.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

A synthesized peptide derived from human BDNF, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

BDNF

Molecular Weight:

Observed Mol.Wt.: 28kD.
Predicted Mol.Wt.: 28kDa(Calculated)..

Subcellular Location:

Secreted.

Tissue Specificity:

P23560 BDNF_HUMAN:
Detected in blood plasma and in saliva (at protein level) (PubMed:11152678, PubMed:19467646). Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.

Description:

Neurotrophins function to regulate naturally occurring cell death of neurons during development. The prototype neurotrophin is nerve growth factor (NGF), originally discovered in the 1950s as a soluble peptide promoting the survival of, and neurite outgrowth from, sympathetic ganglia. Three additional structurally homologous neurotrophic factors have been identified. These include brain-derived neurotrophic factor (BDNF), neurotrophin-3 (NT-3) and neurotrophin-4 (NT-4) (also designated NT-5). These various neurotrophins stimulate the in vitro survival of distinct, but partially overlapping, populations of neurons. The cell surface receptors through which neurotrophins mediate their activity have been identified. For instance, the Trk A receptor is the preferential receptor for NGF, but also binds NT-3 and NT-4. The Trk B receptor binds both BDNF and NT-4 equally well, and binds NT-3 to a lesser extent, while the Trk C receptor only binds NT-3.

Sequence:
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Research Background

Function:

Important signaling molecule that activates signaling cascades downstream of NTRK2 (PubMed:11152678). During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.

Important signaling molecule that activates signaling cascades downstream of NTRK2. Activates signaling cascades via the heterodimeric receptor formed by NGFR and SORCS2 (PubMed:24908487, PubMed:29909994). Signaling via NGFR and SORCS2 plays a role in synaptic plasticity and long-term depression (LTD). Binding to NGFR and SORCS2 promotes neuronal apoptosis. Promotes neuronal growth cone collapse (By similarity).

Post-translational Modifications:

N-glycosylated and glycosulfated, contrary to mature BDNF.

Mature BDNF is produced by proteolytic removal of the propeptide, catalyzed by a FURIN family member. In addition, the precursor form is proteolytically cleaved within the propeptide, but this is not an obligatory intermediate for the production of mature BDNF (PubMed:11152678). Can be converted into mature BDNF by plasmin (PLG) (PubMed:19467646).

Subcellular Location:

Secreted.

Secreted.
Note: A proportion of BDNF is secreted as immature precursor (proBDNF).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Detected in blood plasma and in saliva (at protein level) (PubMed:11152678, PubMed:19467646). Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.

Subunit Structure:

Monomers and homodimers. Binds to NTRK2/TRKB (PubMed:8527932, PubMed:11152678). Can form heterodimers with other neurotrophin family members, such as NTF3 and NTF4 (in vitro), but the physiological relevance of this is not clear (PubMed:7703225, PubMed:10631974). BDNF precursor form: interacts with the heterodimer formed by NGFR and SORCS2 (PubMed:24908487).

Similarity:

Belongs to the NGF-beta family.

Research Fields

Research Fields:

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > cAMP signaling pathway.(View pathway)
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Human Diseases > Substance dependence > Alcoholism.
· Human Diseases > Substance dependence > Cocaine addiction.
· Organismal Systems > Nervous system > Neurotrophin signaling pathway.(View pathway)

Reference Citations:

1). Wang X et al. MANF Promotes Diabetic Corneal Epithelial Wound Healing and Nerve Regeneration by Attenuating Hyperglycemia-Induced Endoplasmic Reticulum Stress. Diabetes 2020 Apr 20 (PubMed: 32312869) [IF=7.720]

2). Hu M et al. Newly generated neurons at 2 months post-status epilepticus are functionally integrated into neuronal circuitry in mouse hippocampus. Exp Neurol 2015 Nov;273:273-87 (PubMed: 26384773) [IF=4.691]

3). Wu J et al. Zhile Capsule Exerts Antidepressant-Like Effects through Upregulation of the BDNF Signaling Pathway and Neuroprotection. Int J Mol Sci 2019 Jan 8;20(1) (PubMed: 30625977) [IF=4.556]

4). Gao HE;Wu DS;Sun L;Yang LD;Qiao YB;Ma S;Wu ZJ;Ruan L;Li FH; et al. Effects of Lifelong Exercise on Age-Related Body Composition, Oxidative Stress, Inflammatory Cytokines, and Skeletal Muscle Proteome in Rats. Mech Ageing Dev 2020 May 15;111262. (PubMed: 32422206) [IF=4.304]

5). Zhang LL et al. Antidepressant-like Effect of Citrus sinensis (L.) Osbeck Essential Oil and Its Main Component Limonene on Mice. J Agric Food Chem 2019 Apr 2 (PubMed: 30905156) [IF=4.192]

6). Xu D et al. XQ-1H alleviates cerebral ischemia in mice through inhibition of apoptosis and promotion of neurogenesis in a Wnt/β-catenin signaling dependent way. Life Sci 2019 Sep 6;235:116844 (PubMed: 31499069) [IF=3.647]

7). Zhang H et al. Effects of Compound 511 on BDNF-TrkB Signaling in the Mice Ventral Tegmental Area in Morphine-Induced Conditioned Place Preference. Cell Mol Neurobiol 2020 Apr 22 (PubMed: 32323150) [IF=3.606]

8). Ge QD et al. MiR-132, miR-204 and BDNF-TrkB signaling pathway may be involved in spatial learning and memory impairment of the offspring rats caused by fluorine and aluminum exposure during the embryonic stage and into adulthood. Environ Toxicol Pharmacol 2018 Oct;63:60-68 (PubMed: 30172012) [IF=3.292]

9). Iqbal M et al. Forced Physical Training Increases Neuronal Proliferation and Maturation with Their Integration into Normal Circuits in Pilocarpine Induced Status Epilepticus Mice. Neurochem Res 2019 Nov;44(11):2590-2605 (PubMed: 31560103) [IF=3.038]

10). Ge QD et al. Differential Expression of miRNAs in the Hippocampi of Offspring Rats Exposed to Fluorine Combined with Aluminum during the Embryonic Stage and into Adulthood. Biol Trace Elem Res 2018 Jul 22 (PubMed: 30033483)

11). Liu B et al. Oxycodone regulates incision-induced activation of neurotrophic factors and receptors in an acute post-surgery pain rat model. J Pain Res 2018 Oct 30;11:2663-2674 (PubMed: 30464584)

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

DF6387-BP
(Blocking peptide available as DF6387-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Zebrafish
100%
Chicken
100%
Rabbit
100%
Xenopus
100%
Dog
100%
Horse
100%
Bovine
100%
Sheep
100%
Pig
100%
High similarity Medium similarity Low similarity No similarity
P23560 as Substrate
Site PTM Type Enzyme
K50 Ubiquitination
T62 Phosphorylation O96017 (CHEK2)
K85 Acetylation
K85 Ubiquitination
T155 Phosphorylation
K174 Ubiquitination
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top