SERPINA1 Antibody | Affinity Biosciences

1/2

Western blot analysis of extracts from Colo205, using SERPINA1 Antibody.

DF6182 at 1/100 staining Human colorectal cancer by IHC-P.

Product:	SERPINA1 Antibody
Catalog:	DF6182
Description:	Rabbit polyclonal antibody to SERPINA1
Application:	WB IHC
Reactivity:	Human, Mouse, Rat
Mol.Wt.:	47kDa; 47kD(Calculated).
Uniprot:	P01009
RRID:	AB_2838148

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

SERPINA1 Antibody detects endogenous levels of total SERPINA1.

RRID:

AB_2838148
Cite Format: Affinity Biosciences Cat# DF6182, RRID:AB_2838148.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

A1A; A1AT; A1AT_HUMAN; AAT; Alpha 1 antiproteinase; Alpha 1 antitrypsin; Alpha 1 antitrypsin null; Alpha 1 protease inhibitor; Alpha-1 protease inhibitor; Alpha-1-antiproteinase; alpha1 proteinase inhibitor; Alpha1AT; Dom1; PI; PI1; PRO2275; Serine (or cysteine) proteinase inhibitor clade A member 1; Serine protease inhibitor 1-1; Serine protease inhibitor A1a; Serpin A1; Serpin A1a; Serpin peptidase inhibitor clade A member 1; Serpina1; Short peptide from AAT; SPAAT; Spi1-1;

Immunogens

Immunogen:

Uniprot:

P01009(A1AT_HUMAN) >>Visit HPA database.

Gene(ID):

SERPINA1(5265)

Expression:

P01009 A1AT_HUMAN:

Ubiquitous. Expressed in leukocytes and plasma.

Description:

The protein encoded by this gene is secreted and is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. Defects in this gene can cause emphysema or liver disease. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Sequence:

P01009 A1AT_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

PTMs - P01009 As Substrate

P01009

Site	PTM Type	Source
T35	Phosphorylation	Uniprot
T37	Phosphorylation	Uniprot
S38	Phosphorylation	Uniprot
N70	N-Glycosylation	Uniprot
N107	N-Glycosylation	Uniprot
K159	Acetylation	Uniprot
K160	Acetylation	Uniprot
Y184	Phosphorylation	Uniprot
K198	Acetylation	Uniprot
C256	S-Nitrosylation	Uniprot
K257	Acetylation	Uniprot
S261	Phosphorylation	Uniprot
N271	N-Glycosylation	Uniprot
S307	Phosphorylation	Uniprot
S309	Phosphorylation	Uniprot
K314	Acetylation	Uniprot
S316	Phosphorylation	Uniprot
T318	Phosphorylation	Uniprot
Y321	Phosphorylation	Uniprot
S325	Phosphorylation	Uniprot
T333	Phosphorylation	Uniprot
S343	Phosphorylation	Uniprot
S383	Phosphorylation	Uniprot
T416	Phosphorylation	Uniprot

Research Backgrounds

P01009_A1AT_HUMAN

Function:

Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin.

reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE).

PTMs:

N-glycosylated. Differential glycosylation produces a number of isoforms. N-linked glycan at Asn-107 is alternatively di-antennary, tri-antennary or tetra-antennary. The glycan at Asn-70 is di-antennary with trace amounts of tri-antennary. Glycan at Asn-271 is exclusively di-antennary. Structure of glycans at Asn-70 and Asn-271 is Hex5HexNAc4. The structure of the antennae is Neu5Ac(alpha1-6)Gal(beta1-4)GlcNAc attached to the core structure Man(alpha1-6)[Man(alpha1-3)]Man(beta1-4)GlcNAc(beta1-4)GlcNAc. Some antennae are fucosylated, which forms a Lewis-X determinant.

Proteolytic processing may yield the truncated form that ranges from Asp-30 to Lys-418.

(Microbial infection) Proteolytically processed by Staphylococcus aureus seryl, cysteinyl, and metallo-proteases.

Subcellular Location:

Secreted. Endoplasmic reticulum.
Note: The S and Z allele are not secreted effectively and accumulate intracellularly in the endoplasmic reticulum.

Secreted>Extracellular space>Extracellular matrix.

Tissue Specificity:

Ubiquitous. Expressed in leukocytes and plasma.

Subunit Structure:

The variants S and Z interact with CANX AND PDIA3.

Family&Domains:

The reactive center loop (RCL) extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site within the RCL, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.

Belongs to the serpin family.

Research Fields

· Organismal Systems > Immune system > Complement and coagulation cascades. (View pathway)

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

SERPINA1 Antibody - #DF6182