Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    IL6 Antibody
  • Catalog No.
    DF6087
  • RRID
    AB_2838055
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Bovine
  • UniProt
  • Mol.Wt
    24kD;
    24kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

Interleukin BSF 2; B cell differentiation factor; B cell stimulatory factor 2; B-cell stimulatory factor 2; BSF 2; BSF-2; BSF2; CDF; CTL differentiation factor; Hepatocyte stimulatory factor; HGF; HSF; Hybridoma growth factor; Hybridoma growth factor Interferon beta-2; IFN-beta-2; IFNB2; IL 6; IL-6; IL6; IL6_HUMAN; Interferon beta 2; Interferon beta-2; Interleukin 6; Interleukin 6 (interferon beta 2); Interleukin BSF 2; Interleukin-6;

Applications:

WB 1:500-1:2000, IHC 1:200, IF/ICC 1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Bovine

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

IL6 Antibody detects endogenous levels of total IL6.

RRID:

AB_2838055
Please cite this product as: Affinity Biosciences Cat# DF6087, RRID:AB_2838055.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human IL6, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

IL6

Molecular Weight:

Observed Mol.Wt.: 24kD.
Predicted Mol.Wt.: 24kDa(Calculated)..

Subcellular Location:

Secreted.

Description:

Interleukin-6 (IL-6) is a multifunctional cytokine with a wide variety of biological functions. IL-6 is implicated in the final differentiation of B-cells into immunoglobulin-secreting cells (1), myeloma and plasmacytoma growth (2), nerve cell differentiation, and activation of hepatocytes and mitogen-stimulated helper T cells (3). Upon activation, IL-6 induces at least three major signaling pathways: JAK/STAT, PI-3 kinase and MAPK (4,5).

Sequence:
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Research Background

Function:

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.

Post-translational Modifications:

N- and O-glycosylated.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Subunit Structure:

Interacts with IL6R (via the N-terminal ectodomain); this interaction may be affected by IL6R-binding with SORL1, hence decreasing IL6 cis signaling. Interacts with SORL1 (via the N-terminal ectodomain); this interaction leads to IL6 internalization and lysosomal degradation. May form a trimeric complex with the soluble SORL1 ectodomain and soluble IL6R receptor; this interaction might stabilize circulating IL6, hence promoting IL6 trans signaling.

Similarity:

Belongs to the IL-6 superfamily.

Research Fields

Research Fields:

· Cellular Processes > Cell growth and death > Cellular senescence.(View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.(View pathway)
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > TNF signaling pathway.(View pathway)
· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.
· Human Diseases > Drug resistance: Antineoplastic > Antifolate resistance.
· Human Diseases > Endocrine and metabolic diseases > Insulin resistance.
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Human Diseases > Neurodegenerative diseases > Prion diseases.
· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
· Human Diseases > Infectious diseases: Bacterial > Legionellosis.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.
· Human Diseases > Infectious diseases: Parasitic > Malaria.
· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Infectious diseases: Viral > Measles.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Cancers: Overview > Pathways in cancer.(View pathway)
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Human Diseases > Immune diseases > Graft-versus-host disease.
· Human Diseases > Cardiovascular diseases > Hypertrophic cardiomyopathy (HCM).
· Organismal Systems > Immune system > Toll-like receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > NOD-like receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway.(View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage.(View pathway)
· Organismal Systems > Immune system > IL-17 signaling pathway.(View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation.(View pathway)
· Organismal Systems > Immune system > Intestinal immune network for IgA production.(View pathway)

Reference Citations:

1). Li X;Wang J;Gong X;Zhang M;Kang S;Shu B;Wei Z;Huang ZS;Li D; et al. Upregulation of BCL-2 by acridone derivative through gene promoter i-motif for alleviating liver damage of NAFLD/NASH. Nucleic Acids Res 2020 Sep 4;48(15):8255-8268. (PubMed: 32710621) [IF=11.501]

Application: WB    Species:mouse;    Sample:liver

Figure 7. Effect of A22 on ameliorating apoptosis, ER stress, inflammation, metabolic syndrome, and fibrogenesis in HF diet-fed mice. (A) Effect of A22 on BCL-2 gene transcription. (B) Effect of A22 on BAX gene transcription. (C) Effect of A22 on expressions of apoptosis-related proteins in liver. The extracted proteins from the liver were immunoblotted with specific antibodies, and quantified based on the loading control of ACTIN. (D) Effect of A22 on ER stress. The UPR proteins (IRE-1, PERK, elF-2 and CHOP) were analyzed by using western Blot. (E) Effect of A22 on expressions of inflammatory factors. (F) Effect of A22 on expressions of fibrogenic proteins.


2). Zhao YZ et al. Ulcerative colitis-specific delivery of keratinocyte growth factor by neutrophils-simulated liposomes facilitates the morphologic and functional recovery of the damaged colon through alleviating the inflammation. J Control Release 2019 Feb 23 (PubMed: 30807805) [IF=7.727]

3). Chen LJ et al. Single xenotransplant of rat brown adipose tissue prolonged the ovarian lifespan of aging mice by improving follicle survival. Aging Cell 2019 Aug 6:e13024 (PubMed: 31389140) [IF=7.238]

4). He XF;Xu JH;Li G;Li MY;Li LL;Pei Z;Zhang LY;Hu XQ; et al. NLRP3-dependent microglial training impaired the clearance of amyloid-beta and aggravated the cognitive decline in Alzheimer’s disease. Cell Death Dis 2020 Oct 13;11(10):849. (PubMed: 33051464) [IF=6.304]

5). Liu W et al. Micheliolide Ameliorates Diabetic Kidney Disease by Inhibiting Mtdh-mediated Renal Inflammation in Type 2 Diabetic db/db Mice. Pharmacol Res 2019 Oct 24:104506 (PubMed: 31669149) [IF=5.893]

6). Qiu LL et al. Dysregulation of BDNF/TrkB signaling mediated by NMDAR/Ca2+/calpain might contribute to postoperative cognitive dysfunction in aging mice. J Neuroinflammation 2020 Jan 16;17(1):23 (PubMed: 31948437) [IF=5.793]

7). Albashari AA;He Y;Albaadani MA;Xiang Y;Ali J;Hu F;Zhang Y;Zhang K;Luo L;Wang J;Ye Q; et al. Titanium Nanotube Modified With Silver Cross-Linked Basic Fibroblast Growth Factor Improves Osteoblastic Activities of Dental Pulp Stem Cells and Antibacterial Effect. Front Cell Dev Biol 2021 Apr 1;9:654654. (PubMed: 33869214) [IF=5.201]

8). She P et al. Dextran sulfate-triamcinolone acetonide conjugate nanoparticles for targeted treatment of osteoarthritis. Int J Biol Macromol 2020 May 7 (PubMed: 32389649) [IF=5.162]

9). Chen C et al. A multifunctional-targeted nanoagent for dual-mode image-guided therapeutic effects on ovarian cancer cells. Int J Nanomedicine 2019 Jan 21;14:753-769 (PubMed: 30718954) [IF=5.115]

10). Tao HC et al. CD47 Deficiency in Mice Exacerbates Chronic Fatty Diet-Induced Steatohepatitis Through Its Role in Regulating Hepatic Inflammation and Lipid Metabolism. Front Immunol 2020 Feb 25;11:148 (PubMed: 32158445) [IF=5.085]

11). Zhang Y et al. Vagus Nerve Stimulation Attenuates Acute Skeletal Muscle Injury Induced by Ischemia-Reperfusion in Rats. Oxid Med Cell Longev 2019 Feb 28;2019:9208949 (PubMed: 30944700) [IF=5.076]

12). Xu X;Zhang X;Gao L;Liu C;You K; et al. Neonatal Hyperoxia Downregulates Claudin-4, Occludin, and ZO-1 Expression in Rat Kidney Accompanied by Impaired Proximal Tubular Development. Oxid Med Cell Longev 2020 Dec 2;2020:2641461. (PubMed: 33343804) [IF=5.076]

13). Shen Y;Sun Z;Mao S;Zhang Y;Jiang W;Wang H; et al. IRF-1 contributes to the pathological phenotype of VSMCs during atherogenesis by increasing CCL19 transcription. Aging (Albany NY) 2020 Nov 16;13(1):933-943. (PubMed: 33424012) [IF=4.831]

14). Li S;Lu Y;Ding D;Ma Z;Xing X;Hua X;Xu J; et al. Fibroblast growth factor 2 contributes to the effect of salidroside on dendritic and synaptic plasticity after cerebral ischemia/reperfusion injury. Aging (Albany NY) 2020 Jun 9;12. (PubMed: 32518214) [IF=4.831]

15). Tao J;Yang P;Xie L;Pu Y;Guo J;Jiao J;Sun L;Lu D; et al. Gastrodin induces lysosomal biogenesis and autophagy to prevent the formation of foam cells via AMPK‐FoxO1‐TFEB signalling axis. J Cell Mol Med 2021 May 10. (PubMed: 33973365) [IF=4.658]

16). Tao J;Yang P;Xie L;Pu Y;Guo J;Jiao J;Sun L;Lu D; et al. Gastrodin induces lysosomal biogenesis and autophagy to prevent the formation of foam cells via AMPK‐FoxO1‐TFEB signalling axis. J Cell Mol Med 2021 May 10. (PubMed: 33973365) [IF=4.486]

17). Tan H;Ding Z;Zhang C;Yan J;Yang Y;Li P; et al. The Programmed Cell Death Ligand-1/Programmed Cell Death-1 Pathway Mediates Pregnancy-Induced Analgesia via Regulating Spinal Inflammatory Cytokines. Anesth Analg 2021 Sep 14;133(5):1321-1330. (PubMed: 34524124) [IF=4.305]

18). Li C;Dong N;Wu B;Mo Z;Xie J;Lu Q; et al. Dihydroberberine, an isoquinoline alkaloid, exhibits protective effect against dextran sulfate sodium-induced ulcerative colitis in mice. Phytomedicine 2021 Sep;90:153631. (PubMed: 34253428) [IF=4.268]

19). Han X et al. Autolysosomal degradation of cytosolic chromatin fragments antagonizes oxidative stress-induced senescence. J Biol Chem 2020 Feb 11 (PubMed: 32047109) [IF=4.167]

20). Sun J;Xue P;Liu J;Huang L;Lin G;Ran K;Yang J;Lu C;Zhao YZ;Xu HL; et al. Self-Cross-Linked Hydrogel of Cysteamine-Grafted γ-Polyglutamic Acid Stabilized Tripeptide KPV for Alleviating TNBS-Induced Ulcerative Colitis in Rats. ACS Biomater Sci Eng 2021 Oct 11;7(10):4859-4869. (PubMed: 34547895) [IF=4.152]

21). Sun J;Xue P;Liu J;Huang L;Lin G;Ran K;Yang J;Lu C;Zhao YZ;Xu HL; et al. Self-Cross-Linked Hydrogel of Cysteamine-Grafted γ-Polyglutamic Acid Stabilized Tripeptide KPV for Alleviating TNBS-Induced Ulcerative Colitis in Rats. ACS Biomater Sci Eng 2021 Oct 11;7(10):4859-4869. (PubMed: 34547895) [IF=4.152]

22). Ren QC et al. Total flavonoids from sea buckthorn ameliorates lipopolysaccharide/cigarette smoke-induced airway inflammation. Phytother Res 2019 Jun 17 (PubMed: 31209984) [IF=4.087]

23). Ge MH;Tian H;Mao L;Li DY;Lin JQ;Hu HS;Huang SC;Zhang CJ;Mei XF; et al. Zinc attenuates ferroptosis and promotes functional recovery in contusion spinal cord injury by activating Nrf2/GPX4 defense pathway. CNS Neurosci Ther 2021 May 5;27(9):1023-1040. (PubMed: 33951302) [IF=4.074]

24). Yi L et al. Inflammation-mediated SOD-2 upregulation contributes to epithelial-mesenchymal transition and migration of tumor cells in aflatoxin G1-induced lung adenocarcinoma. Sci Rep 2017 Aug 11;7(1):7953 (PubMed: 28801561) [IF=3.998]

Application: WB    Species:human;    Sample:Not available

Figure 3. Tumor-associated infammatory microenvironment is elicited in AFG1-induced lung adenocarcinoma. Te RNA and protein samples as well as parafn sections isolated from the lungadenocarcinoma or control lung tissues were collected from our previous study. (a) Several cytokines and chemokines expression at mRNA level were determined by real-time PCR. Data was shown as mean±SD (n=4, *p<0.05, compared to control group). (b) Te expression of IL-6 and TNF-α at protein level was shown by Western blot. Band intensity is coming from densitometry, and data was shown as mean±SD (n=3, *p<0.05, compared to control group). (c) Representative immunohistochemical staining of IL-6 and TNF-α in AFG1-induced lung adenocarcinoma. (d) Representative immunohistochemical staining of CD68 in lung tissues close to lung adenocarcinoma and control lung tissues. Black arrow points to positive cell.

Application: IHC    Species:human;    Sample:Not available

Figure 3. Tumor-associated infammatory microenvironment is elicited in AFG1-induced lung adenocarcinoma. Te RNA and protein samples as well as parafn sections isolated from the lungadenocarcinoma or control lung tissues were collected from our previous study. (a) Several cytokines and chemokines expression at mRNA level were determined by real-time PCR. Data was shown as mean±SD (n=4, *p<0.05, compared to control group). (b) Te expression of IL-6 and TNF-α at protein level was shown by Western blot. Band intensity is coming from densitometry, and data was shown as mean±SD (n=3, *p<0.05, compared to control group). (c) Representative immunohistochemical staining of IL-6 and TNF-α in AFG1-induced lung adenocarcinoma. (d) Representative immunohistochemical staining of CD68 in lung tissues close to lung adenocarcinoma and control lung tissues. Black arrow points to positive cell.


25). Xu M;Ye Z;Zhao X;Guo H;Gong X;Huang R; et al. Deficiency of tenascin-C attenuated cardiac injury by inactivating TLR4/NLRP3/caspase-1 pathway after myocardial infarction. Cell Signal 2021 Jul 13;86:110084. (PubMed: 34271086) [IF=3.968]

26). He JB;Ma XY;Li WJ;Liu YY;Lin DS; et al. Exenatide inhibits necrosis by enhancing angiogenesis and ameliorating ischemia/reperfusion injury in a random skin flap rat model. Int Immunopharmacol 2020 Nov 16;107192. (PubMed: 33214096) [IF=3.943]

27). Feng X et al. Protective effect of citicoline on random flap survival in a rat mode. Int Immunopharmacol 2020 Apr 1;83:106448 (PubMed: 32247268) [IF=3.943]

28). Zhang YX;Zhang XT;Li HJ;Zhou TF;Zhou AC;Zhong ZL;Liu YH;Yuan LL;Zhu HY;Luan D;Tong JC; et al. Antidepressant-like effects of helicid on a chronic unpredictable mild stress-induced depression rat model: Inhibiting the IKK/IκBα/NF-κB pathway through NCALD to reduce inflammation. Int Immunopharmacol 2021 Apr;93:107165. (PubMed: 33578182) [IF=3.943]

29). Wang M et al. Berberine combined with cyclosporine A alleviates acute graft-versus-host disease in murine models. Int Immunopharmacol 2020 Feb 9;81:106205 (PubMed: 32050154) [IF=3.943]

30). Lu L et al. Shexiang Baoxin Pill Alleviates the Atherosclerotic Lesions in Mice via Improving Inflammation Response and Inhibiting Lipid Accumulation in the Arterial Wall. Mediators Inflamm 2019 Jul 11;2019:6710759 (PubMed: 31379468) [IF=3.758]

31). Zhao M;Wang S;Zuo A;Zhang J;Wen W;Jiang W;Chen H;Liang D;Sun J;Wang M; et al. HIF-1α/JMJD1A signaling regulates inflammation and oxidative stress following hyperglycemia and hypoxia-induced vascular cell injury. Cell Mol Biol Lett 2021 Sep 3;26(1):40. (PubMed: 34479471) [IF=3.451]

32). Ji S et al. Resveratrol promotes oxidative stress to drive DLC1 mediated cellular senescence in cancer cells. Exp Cell Res 2018 Sep 15;370(2):292-302 (PubMed: 29964052) [IF=3.383]

33). Li D et al. LPS-induced inflammation delays the transportation of ASP+ due to down-regulation of OCTN1/2 in alveolar epithelial cells. J Drug Target 2019 Oct 8:1-31 (PubMed: 31591905) [IF=3.380]

34). Li J;Jia Z;Zhang Q;Dai J;Kong J;Fan Z;Li G; et al. Inhibition of ERK1/2 phosphorylation attenuates spinal cord injury induced astrocyte activation and inflammation through negatively regulating aquaporin-4 in rats. Brain Res Bull 2021 May;170:162-173. (PubMed: 33592275) [IF=3.370]

35). Luoreng ZM;Wei DW;Wang XP; et al. MiR-125b regulates inflammation in bovine mammary epithelial cells by targeting the NKIRAS2 gene. Vet Res 2021 Sep 17;52(1):122. (PubMed: 34535180) [IF=3.357]

36). Huang X et al. Leucovorin ameliorated methotrexate induced intestinal toxicity via modulation of the gut microbiota. Toxicol Appl Pharmacol 2020 Feb 19;391:114900 (PubMed: 32061593) [IF=3.347]

37). Huang G et al. Protective effects of icariin on dorsal random skin flap survival: An experimental study. Eur J Pharmacol 2019 Aug 8:172600 (PubMed: 31401155) [IF=3.263]

38). Hu R et al. Salidroside ameliorates endothelial inflammation and oxidative stress by regulating the AMPK/NF-κB/NLRP3 signaling pathway in AGEs-induced HUVECs. Eur J Pharmacol 2020 Jan 15;867:172797 (PubMed: 31747547) [IF=3.263]

39). Ou F;Huang Y;Sun J;Su K;He Y;Zeng R;Tang D;Liao G; et al. Yohimbine Ameliorates Temporomandibular Joint Chondrocyte Inflammation with Suppression of NF-κB Pathway. Inflammation 2020 Aug 12. (PubMed: 32789555) [IF=3.212]

40). Yin Q;Pi X;Jiang Y;Ren G;Liu Z;Liu H;Wang M;Sun W;Li S;Gao Z;Li D;Yin J; et al. An immuno-blocking agent targeting IL-1β and IL-17A reduces the lesion of DSS-induced ulcerative colitis in mice. Inflammation 2021 Apr 20. (PubMed: 33877484) [IF=3.212]

41). Song XX;Jin LY;Li XF;Luo Y;Yu BW; et al. Substance P Mediates Estrogen Modulation Proinflammatory Cytokines Release in Intervertebral Disc. Inflammation 2020 Sep 23. (PubMed: 32965648) [IF=3.212]

42). Sun J et al. Suberoylanilide Hydroxamic Acid Attenuates Interleukin-1β-Induced Interleukin-6 Upregulation by Inhibiting the Microtubule Affinity-Regulating Kinase 4/Nuclear Factor-κB Pathway in Synovium-Derived Mesenchymal Stem Cells from the Temporomandibular Joint. Inflammation 2020 Apr 11 (PubMed: 32279160) [IF=3.212]

43). Lu Z;Xiong W;Xiao S;Lin Y;Yu K;Yue G;Liu Q;Li F;Liang J; et al. Huanglian Jiedu Decoction ameliorates DSS-induced colitis in mice via the JAK2/STAT3 signalling pathway. Chin Med 2020 May 8;15:45. (PubMed: 32411291)

44). Jiang D;Liu C;Chen Y;Xing X;Zheng D;Guo Z;Lin S; et al. Metabolomics Study of Whole-body Vibration on Lipid Metabolism of Skeletal Muscle in Aging Mice. Int J Sports Med 2021 May;42(5):464-477. (PubMed: 33124015)

45). Li Z;Xu D;Jing J;Li F; et al. Network pharmacology‑based study to explore the mechanism of the Yiqi Gubiao pill in lung cancer treatment. Oncol Lett 2021 Apr;21(4):321. (PubMed: 33692853)

46). Zhang X;Qin Y;Wan X;Liu H;Iv C;Ruan W;Lu L;He L;Guo X; et al. Hydroxytyrosol Plays Antiatherosclerotic Effects through Regulating Lipid Metabolism via Inhibiting the p38 Signal Pathway. Biomed Res Int 2020 Jun 22;2020:5036572. (PubMed: 32685494)

47). Li X;Wang W;Chen Q;Zhou Y;Wang L;Huang H; et al. Antinociceptive effects of IL-6R vs. glucocorticoid receptors during rat hind paw inflammatory pain. Neurosci Lett 2020 Sep 6;738:135356. (PubMed: 32898615)

48). Jia J;Sun J;Liao W;Qin L;Su K;He Y;Zhang J;Yang R;Zhang Z;Sun Y; et al. Knockdown of long non‑coding RNA AK094629 attenuates the interleukin‑1β induced expression of interleukin‑6 in synovium‑derived mesenchymal stem cells from the temporomandibular joint. Mol Med Rep 2020 May 28. (PubMed: 32468015)

49). Chen L;Hua Y; et al. Autophagy of periodontal ligament inhibits inflammation and reduces the decline of bone density during orthodontic tooth movement of mice. Arch Oral Biol 2020 Oct 28;121:104960. (PubMed: 33171395)

50). Wang X et al. Antiprolactinoma Effect of Hordenine by Inhibiting MAPK Signaling Pathway Activation in Rats. Evid Based Complement Alternat Med 2020 Apr 23;2020:3107290 (PubMed: 32382283)

51). Zhang K;Li Z;Lu Y;Xiang L;Sun J;Zhang H; et al. Silencing of Vangl2 attenuates the inflammation promoted by Wnt5a via MAPK and NF-κB pathway in chondrocytes. J Orthop Surg Res 2021 Feb 15;16(1):136. (PubMed: 33588909)

52). Feng X et al. Effects of Asiaticoside Treatment on the Survival of Random Skin Flaps in Rats. J Invest Surg 2019 Mar 21:1-11 (PubMed: 30898065)

53). Tan L;Liu L;Yao J;Piao C; et al. miR-145-5p attenuates inflammatory response and apoptosis in myocardial ischemia-reperfusion injury by inhibiting NOH-1. Exp Anim 2021 Mar 4. (PubMed: 33658472)

54). et al. Nanoparticle-mediated intravesical delivery of conditioned medium derived from mesenchymal stem cells for interstitial cystitis/bladder pain syndrome treatment.

55). et al. Roles of Crosstalk between Astrocytes and Microglia in Triggering Neuroinflammation and Brain Edema Formation in 1,2-Dichloroethane-Intoxicated Mice.

56). Fang M;He J;Ma X;Li W;Lin D; et al. Protective effects of dexmedetomidine on the survival of random flaps. Biomed Pharmacother 2020 May 20;128:110261. (PubMed: 32446114)

57). Wang Y;Zhang J;Gao T;Zhang N;He J;Wu F; et al. Covalent immobilization of DJK-5 peptide on porous titanium for enhanced antibacterial effects and restrained inflammatory osteoclastogenesis. Colloids Surf B Biointerfaces 2021 Jun;202:111697. (PubMed: 33756295)

58). et al. Thermo-sensitive hydrogel with mussel-inspired adhesion enhanced the non-fibrotic repair effect of EGF on colonic mucosa barrier of TNBS-induced ulcerative colitis rats through macrophage polarizing.

59). et al. Effect of sericin on the p38MAPK signaling pathway and NLRP3 inflammasome in the kidney of type 2 diabetic rats.

60). et al. Therapeutic targets and biological mechanisms of curcumol on atherosclerosis: A study based on network pharmacology approach and biological studies.

61). Kai Kang et al. FGF21 Attenuates Neurodegeneration though Modulating Neuroinflammation and Oxidant-stress.

62). et al. Thermosensitive bFGF-Modified Hydrogel with Dental Pulp Stem Cells on Neuroinflammation of Spinal Cord Injury.

63). et al. Pterocephin A, a Novel Triterpenoid Saponin from Pterocephalus hookeri Induced Liver Injury by Activation of Necroptosis.

64). et al. Olanzapine-Induced Activation of Hypothalamic Astrocytes and Toll-Like Receptor-4 Signaling via Endoplasmic Reticulum Stress Were Related to Olanzapine-Induced Weight Gain.

65). Duan F;Guo L;Yang L;Han Y;Thakur A;Nilsson-Payant BE;Wang P;Zhang Z;Ma CY;Zhou X;Han T;Zhang T;Wang X;Xu D;Duan X;Xiang J;Tse HF;Liao C;Luo W;Huang FP;Chen YW;Evans T;Schwartz RE;tenOever B;Ho DD;Chen S;Lian Q;Chen HJ; et al. Modeling COVID-19 with Human Pluripotent Stem Cell-Derived Cells Reveals Synergistic Effects of Anti-inammatory Macrophages with ACE2 Inhibition Against SARS-CoV-2. Res Sq 2020 Aug 20;rs.3.rs-62758. (PubMed: 32839764)

66). et al. Depletion of Fractalkine Ameliorates Renal Injury and Treg Cell Apoptosis Via the p38MAPK Pathway in Lupus-prone Mice.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

DF6087-BP
(Blocking peptide available as DF6087-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Bovine
100%
Dog
78%
Pig
71%
Horse
71%
Sheep
71%
Xenopus
0%
Zebrafish
0%
Chicken
0%
Rabbit
0%
High similarity Medium similarity Low similarity No similarity
P05231 as Substrate
Site PTM Type Enzyme
N73 N-Glycosylation
S81 Phosphorylation
K94 Ubiquitination
S135 Phosphorylation
S136 Phosphorylation
T165 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top