LC3A/B Antibody - AF5402

Price Size
$280 100ul
$350 200ul

Same day delivery

For pricing and ordering contact:

local distributors
  • Product Name
    LC3A/B Antibody
  • Catalog No.
    AF5402
  • RRID
    AB_2837886
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig, Zebrafish, Bovine, Sheep, Dog, Xenopus
  • UniProt
  • Mol.Wt
    14kD,16 kD;
    14kDa,15kDa(Calculated).
  • Concentration
    1mg/ml

  • Browse similar products>>

Related Products

 #AF5402-BP LC3A/B Blocking Peptide $350/1mg

Product Information

Alternative Names:Expand▼

ATG8E; Autophagy-related protein LC3 A; Autophagy-related ubiquitin-like modifier LC3 A; LC3; LC3A; MAP1 light chain 3 like protein 1; MAP1 light chain 3-like protein 1; MAP1A/1B light chain 3 A; MAP1A/MAP1B LC3 A; MAP1A/MAP1B light chain 3 A; MAP1ALC3; MAP1BLC3; Map1lc3a; Microtubule associated proteins 1A/1B light chain 3; Microtubule-associated protein 1 light chain 3 alpha; Microtubule-associated proteins 1A and 1B, light chain 3; Microtubule-associated proteins 1A/1B light chain 3A; MLP3A_HUMAN; ATG8F; Autophagy-related protein LC3 B; Autophagy-related ubiquitin-like modifier LC3 B; LC3B; LC3II; MAP1 light chain 3 like protein 2; MAP1 light chain 3-like protein 2; MAP1A/1BLC3; MAP1A/MAP1B LC3 B; MAP1A/MAP1B light chain 3 B; MAP1ALC3; MAP1LC3B a; Map1lc3b; Microtubule associated protein 1 light chain 3 beta; Microtubule-associated protein 1 light chain 3 beta; Microtubule-associated proteins 1A/1B light chain 3B; MLP3B_HUMAN;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig, Zebrafish, Bovine, Sheep, Dog, Xenopus

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

LC3A/B Antibody detects endogenous levels of total LC3A/B.

RRID:

AB_2837886
Please cite this product as: Affinity Biosciences Cat# AF5402, RRID:AB_2837886.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human LC3B, corresponding to a region within N-terminal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

MAP1LC3A,MAP1LC3B

Molecular Weight:

Observed Mol.Wt.: 14kD,16 kD.
Predicted Mol.Wt.: 14kDa,15kDa(Calculated)..

Subcellular Location:

Cytoplasm > cytoskeleton. Endomembrane system. Cytoplasmic vesicle > autophagosome membrane. LC3-II binds to the autophagic membranes.

Tissue Specificity:

Q9H492 MLP3A_HUMAN:
Most abundant in heart, brain, liver, skeletal muscle and testis but absent in thymus and peripheral blood leukocytes.

Q9GZQ8 MLP3B_HUMAN:
Most abundant in heart, brain, skeletal muscle and testis. Little expression observed in liver.

Description:

Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production.

Sequence:
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV

Research Background

Function:

Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Through its interaction with the reticulophagy receptor TEX264, paticipates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover.

Post-translational Modifications:

The precursor molecule is cleaved by ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II.

The Legionella effector RavZ is a deconjugating enzyme that produces an ATG8 product that would be resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine.

Phosphorylation at Ser-12 by PKA inhibits conjugation to phosphatidylethanolamine (PE). Interaction with MAPK15 reduces the inhibitory phosphorylation and increases autophagy activity.

Subcellular Location:

Cytoplasm>Cytoskeleton. Endomembrane system>Lipid-anchor. Cytoplasmic vesicle>Autophagosome membrane>Lipid-anchor. Cytoplasmic vesicle>Autophagosome.
Note: LC3-II binds to the autophagic membranes.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Most abundant in heart, brain, liver, skeletal muscle and testis but absent in thymus and peripheral blood leukocytes.

Subunit Structure:

3 different light chains, LC1, LC2 and LC3, can associate with MAP1A and MAP1B proteins (By similarity). Interacts with TP53INP1 and TP53INP2. Directly interacts with SQSTM1; this interaction leads to MAP1LC3A recruitment to inclusion bodies containing polyubiquitinated protein aggregates and to inclusion body degradation by autophagy. Interacts with ATG13. Interacts with ULK1. Interacts with TBC1D5. Found in a complex with UBQLN1 and UBQLN2. Interacts with UBQLN4 (via STI1 1 and 2 domains). Interacts with UBQLN1 in the presence of UBQLN4. Interacts with TRIM5. Interacts with MEFV. Interacts with RETREG1, RETREG2 and RETREG3. Interacts with PICALM. Interacts with the reticulophagy receptor TEX264.

Similarity:

Belongs to the ATG8 family.

Function:

Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Promotes primary ciliogenesis by removing OFD1 from centriolar satellites via the autophagic pathway. Through its interaction with the reticulophagy receptor TEX264, paticipates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover.

Post-translational Modifications:

The precursor molecule is cleaved by ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II.

The Legionella effector RavZ is a deconjugating enzyme that produces an ATG8 product that would be resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine.

Phosphorylation at Thr-12 by PKA inhibits conjugation to phosphatidylethanolamine (PE) (By similarity). Interaction with MAPK15 reduces the inhibitory phosphorylation and increases autophagy activity.

Subcellular Location:

Cytoplasm>Cytoskeleton. Endomembrane system>Lipid-anchor. Cytoplasmic vesicle>Autophagosome membrane>Lipid-anchor. Cytoplasmic vesicle>Autophagosome.
Note: LC3-II binds to the autophagic membranes. Localizes also to discrete punctae along the ciliary axoneme (By similarity).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Most abundant in heart, brain, skeletal muscle and testis. Little expression observed in liver.

Subunit Structure:

3 different light chains, LC1, LC2 and LC3, can associate with MAP1A and MAP1B proteins (By similarity). Interacts at microtubules with CABP1 (via EF-hands 1 and 2) but not with calmodulin. Interacts with FYCO1 (via C-terminus). Interacts with TP53INP1 and TP53INP2. Interacts with TBC1D25. Directly interacts with SQSTM1; this interaction leads to MAP1LC3B recruitment to inclusion bodies containing polyubiquitinated protein aggregates and to inclusion body degradation by autophagy. Interacts with ATG4B, MAPK15 and BNIP3. Interacts with MAPB1, KEAP1, PCM1, OFD1, CEP131, and TECPR2. Interacts with TBC1D5. Found in a complex with UBQLN1 and UBQLN2. Interacts with UBQLN4 (via STI1 1 and 2 domains). Interacts with UBQLN1 in the presence of UBQLN4. Interacts with ATG13. Interacts with RETREG2, RETREG1 and RETREG3. No interaction, or very weak, with WDFY3. Interacts with PLCL1; the interaction inhibits autophagosome formation (By similarity). Interacts with TRIM16. Interacts with CRY1 and PER2 (By similarity). Interacts with the reticulophagy receptor TEX264.

Similarity:

Belongs to the ATG8 family.

Research Fields

Research Fields:

· Cellular Processes > Cell growth and death > Ferroptosis.(View pathway)

Protocols & Troubleshooting

Reference Citations:

1). Shao L et al. Inhibition of mTORC1 signaling protects kidney from irradiation-induced toxicity via accelerating recovery of renal stem-like cells. Stem Cell Res Ther 2018 Aug 14;9(1):219 (PubMed: 30107854) [IF=5.116]
2). Wang M et al. Atractylenolide III Attenuates Muscle Wasting in Chronic Kidney Disease via the Oxidative Stress-Mediated PI3K/AKT/mTOR Pathway. Oxid Med Cell Longev 2019 Apr 18;2019:1875471 (PubMed: 31178951) [IF=5.076]
3). Liu D;Wang B;Qiu M;Huang Y; et al. MiR‐19b‐3p accelerates bone loss after spinal cord injury by suppressing osteogenesis via regulating PTEN/Akt/mTOR signalling. J Cell Mol Med 2020 Dec 17. (PubMed: 33332749) [IF=4.658]
4). Hu R;Wang MQ;Liu LY;You HY;Wu XH;Liu YY;Wang YJ;Lu L;Xiao W;Wei LB; et al. Calycosin inhibited autophagy and oxidative stress in chronic kidney disease skeletal muscle atrophy by regulating AMPK/SKP2/CARM1 signalling pathway. J Cell Mol Med 2020 Oct;24(19):11084-11099. (PubMed: 32910538) [IF=4.658]
5). Gu L et al. Andrographolide Protects PC12 Cells Against β-Amyloid-Induced Autophagy-Associated Cell Death Through Activation of the Nrf2-Mediated p62 Signaling Pathway. Int J Mol Sci 2018 Sep 19;19(9) (PubMed: 30235892) [IF=4.556]
6). Cao Y et al. Punicalagin Prevents Inflammation in LPS-Induced RAW264.7 Macrophages by Inhibiting FoxO3a/Autophagy Signaling Pathway. Nutrients 2019 Nov 15;11(11) (PubMed: 31731808) [IF=4.546]
7). Zhuo J et al. Patchouli alcohol protects against chronic unpredictable mild stress-induced depressant-like behavior through inhibiting excessive autophagy via activation of mTOR signaling pathway. Biomed Pharmacother 2020 Mar 31;127:110115 (PubMed: 32244196) [IF=4.545]
8). Yu Z;Li Q;Wang Y;Li P; et al. A Potent Protective Effect of Baicalein on Liver Injury by Regulating Mitochondria-Related Apoptosis. Apoptosis 2020 May 14. (PubMed: 32409930) [IF=4.543]
9). Sengking J;Oka C;Wicha P;Yawoot N;Tocharus J;Chaichompoo W;Suksamrarn A;Tocharus C; et al. Neferine Protects Against Brain Damage in Permanent Cerebral Ischemic Rat Associated with Autophagy Suppression and AMPK/mTOR Regulation. Mol Neurobiol 2021 Sep 8. (PubMed: 34498225) [IF=4.500]
10). Liu D;Wang B;Qiu M;Huang Y; et al. MiR‐19b‐3p accelerates bone loss after spinal cord injury by suppressing osteogenesis via regulating PTEN/Akt/mTOR signalling. J Cell Mol Med 2020 Dec 17. (PubMed: 33332749) [IF=4.486]
11). Hu R;Wang MQ;Liu LY;You HY;Wu XH;Liu YY;Wang YJ;Lu L;Xiao W;Wei LB; et al. Calycosin inhibited autophagy and oxidative stress in chronic kidney disease skeletal muscle atrophy by regulating AMPK/SKP2/CARM1 signalling pathway. J Cell Mol Med 2020 Oct;24(19):11084-11099. (PubMed: 32910538) [IF=4.486]
12). Yang L;Lin H;Lin W;Xu X; et al. Exercise Ameliorates Insulin Resistance of Type 2 Diabetes through Motivating Short-Chain Fatty Acid-Mediated Skeletal Muscle Cell Autophagy. Biology (Basel) 2020 Aug 3;9(8):E203. (PubMed: 32756447) [IF=4.385]
13). Gao HE;Wu DS;Sun L;Yang LD;Qiao YB;Ma S;Wu ZJ;Ruan L;Li FH; et al. Effects of Lifelong Exercise on Age-Related Body Composition, Oxidative Stress, Inflammatory Cytokines, and Skeletal Muscle Proteome in Rats. Mech Ageing Dev 2020 May 15;111262. (PubMed: 32422206) [IF=4.304]
14). Feng X et al. Mycobacterium smegmatis Induces Neurite Outgrowth and Differentiation in an Autophagy-Independent Manner in PC12 and C17.2 Cells. Front Cell Infect Microbiol 2018 Jun 19;8:201 (PubMed: 29988402) [IF=4.123]
15). Li J;Sun Z;Lin Y;Yan Y;Yan H;Jing B;Han Z; et al. Syndecan 4 contributes to osteoclast differentiation induced by RANKL through enhancing autophagy. Int Immunopharmacol 2020 Dec 21;91:107275. (PubMed: 33360085) [IF=3.943]
16). Zhang S et al. Dorsal Root Ganglion Maintains Stemness of Bone Marrow Mesenchymal Stem Cells by Enhancing Autophagy through the AMPK/mTOR Pathway in a Coculture System. Stem Cells Int 2018 Sep 30;2018:8478953 (PubMed: 30363977) [IF=3.869]
17). Cao Y;Ren G;Zhang Y;Qin H;An X;Long Y;Chen J;Yang L; et al. A new way for punicalagin to alleviate insulin resistance: regulating gut microbiota and autophagy. Food Nutr Res 2021 Jul 1;65. (PubMed: 34262422) [IF=3.647]
18). Luo R et al. Berberine ameliorates oxidative stress-induced apoptosis by modulating ER stress and autophagy in human nucleus pulposus cells. Life Sci 2019 Apr 29 (PubMed: 31047897) [IF=3.647]
19). Yao G;Li R;Du J;Yao Y; et al. Angiogenic factor with G patch and FHA domains 1 protects retinal vascular endothelial cells under hyperoxia by inhibiting autophagy. J Biochem Mol Toxicol 2020 Jul 7;e22572. (PubMed: 32633013) [IF=3.606]
20). Wu CZ et al. HMGB1/RAGE axis mediates the apoptosis, invasion, autophagy, and angiogenesis of the renal cell carcinoma. Onco Targets Ther 2018 Aug 1;11:4501-4510 (PubMed: 30122942) [IF=3.337]
21). Pi Y;Tian X;Ma J;Zhang H;Huang X; et al. Vitamin D alleviates hypoxia/reoxygenation-induced injury of human trophoblast HTR-8 cells by activating autophagy. Placenta 2021 May 30;111:10-18. (PubMed: 34126416) [IF=3.177]
22). Jiao XF et al. Effects of Acute Fluorene-9-Bisphenol Exposure on Mouse Oocyte in vitro Maturation and Its Possible Mechanisms. Environ Mol Mutagen 2018 Nov 30 (PubMed: 30499614) [IF=3.131]
23). Su R et al. The potential immunotoxicity of fine particulate matter based on SD rat spleen. Environ Sci Pollut Res Int 2019 Aug;26(23):23958-23966 (PubMed: 31218585) [IF=3.056]
24). Tian J;Yang L;Wang P;Yang L;Fan Z; et al. Exogenous CGRP Regulates Apoptosis and Autophagy to Alleviate Traumatic Brain Injury Through Akt/mTOR Signalling Pathway. Neurochem Res 2020 Oct 15. (PubMed: 33063244) [IF=3.038]
25). Xue J;Gruber F;Tschachler E;Zhao Y; et al. Crosstalk between oxidative stress, autophagy and apoptosis in Hemoporfin Photodynamic Therapy treated human umbilical vein endothelial cells. Photodiagnosis Photodyn Ther 2020 Dec 8;102137. (PubMed: 33307232)
26). Tang Z et al. Human tissue kallikrein 1 ameliorates erectile function via modulation of macroautophagy in aged transgenic rats. Andrology 2018 Jun 25 (PubMed: 29939496)
27). Zhang KQ et al. Effect of probucol on autophagy and apoptosis in the penile tissue of streptozotocin-induced diabetic rats. Asian J Androl 2019 Aug 23 (PubMed: 31464204)
28). Zhang S;Huang X;Xiu H;Zhang Z;Zhang K;Cai J;Cai Z;Chen Z;Zhang Z;Cui W;Zhang G;Xiang M; et al. The attenuation of Th1 and Th17 responses via autophagy protects against methicillin-resistant Staphylococcus aureus-induced sepsis. Microbes Infect 2021 Apr 28;104833. (PubMed: 33930602)
29). Zhu Y;Su Y;Zhang J;Zhang Y;Li Y;Han Y;Dong X;Li W;Li W; et al. Astragaloside IV alleviates liver injury in type 2 diabetes due to promotion of AMPK/mTOR‑mediated autophagy. Mol Med Rep 2021 Jun;23(6):437. (PubMed: 33846768)
30). Xiaojun Li et al. Recombinant human irisin regulated collagen II, matrix metalloproteinase‑13 and the Wnt/β‑catenin and NF‑κB signaling pathways in interleukin‑1β‑induced human SW1353 cells. EXP THER MED 2020 Feb 26
31). Zhang Z;Han K;Wang C;Sun C;Jia N; et al. Dioscin Protects against Aβ1–42 Oligomers-Induced Neurotoxicity via the Function of SIRT3 and Autophagy. Chem Pharm Bull (Tokyo) 2020;68(8):717-725. (PubMed: 32741912)
32). Li R;Chen L;Yao GM;Yan HL;Wang L; et al. Effects of quercetin on diabetic retinopathy and its association with NLRP3 inflammasome and autophagy. Int J Ophthalmol 2021 Jan 18;14(1):42-49. (PubMed: 33469482)
33). Chen L;Wang H;Ge S;Tai S; et al. IL-6/STAT3 pathway is involved in the regulation of autophagy in chronic non-bacterial prostatitis cells, and may be affected by the NLRP3 inflammasome. Ultrastruct Pathol 2021 Aug 23;1-10. (PubMed: 34423720)
34). et al. Effects of Sancai Lianmei Particle on autophagy and apoptosis in testes of diabetic mice via the Nrf2/HO-1 pathway. Int J Clin Exp Med 2019;12(6):6720-6732
35). Li R;Chen L;Yao GM;Yan HL;Wang L; et al. Effects of quercetin on diabetic retinopathy and its association with NLRP3 inflammasome and autophagy. Int J Ophthalmol 2021 Jan 18;14(1):42-49. (PubMed: 33469482)
36). et al. Hispidulin inhibits proliferation, migration and invasion by promoting autophagy via regulation of PPARγ activation in prostate cancer cells and xenograft models.
37). et al. FTO accelerates ovarian cancer cell growth by promoting proliferation, inhibiting apoptosis, and activating autophagy.
38). et al. Homocysteine induces human mesangial cell apoptosis via the involvement of autophagy and endoplasmic reticulum stress.
No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF5402-BP
(Blocking peptide available as AF5402-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide（0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Bovine
100%
Sheep
100%
Dog
100%
Xenopus
100%
Zebrafish
93%
Horse
0%
Chicken
0%
Rabbit
0%
High similarity Medium similarity Low similarity No similarity
Q9H492/Q9GZQ8 as Substrate
Site PTM Type Enzyme
S12 Phosphorylation P17612 (PRKACA)
K42 Ubiquitination
K49 Acetylation
K49 Ubiquitination
T50 Phosphorylation Q13188 (STK3) , Q13043 (STK4)
K51 Acetylation
S92 Phosphorylation
T93 Phosphorylation
Site PTM Type Enzyme
K5 Ubiquitination
T6 Phosphorylation
R21 Methylation
T29 Phosphorylation
K30 Ubiquitination
K42 Ubiquitination
K49 Ubiquitination
K51 Ubiquitination
K65 Ubiquitination
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top