Apoptosis regulator BAX; BAX; Bax-protein; BAX_HUMAN; BAXA; Baxdelta2G9; Baxdelta2G9omega; Baxdelta2omega; Bcl-2-like protein 4; BCL2 associated X protein; BCL2 associated X protein omega; BCL2 associated X protein transcript variant delta2; Bcl2-L-4; BCL2L4; membrane isoform alpha;
WB: 1:500-1:3000, IHC: 1:50-1:200, IF/ICC 1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Human, Mouse, Rat
Pig(100%), Bovine(100%), Horse(100%), Rabbit(100%), Dog(100%)
Rabbit
Polyclonal
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Bax Antibody detects endogenous levels of total Bax.
AB_2833304
Please cite this product as: Affinity Biosciences Cat# AF0120, RRID:AB_2833304.
Liquid
1mg/ml
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, glycerol.Store at -20 °C.Stable for 12 months from date of receipt.
A synthesized peptide derived from human Bax, corresponding to a region within the internal amino acids.
>>Visit The Human Protein Atlas
BAX
Observed Mol.Wt.: 21kD.
Predicted Mol.Wt.: 21kDa(Calculated)..
Cytoplasm and Mitochondrion membrane. Cytoplasm. Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane.
Q07812 BAX_HUMAN:
Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.
Bax Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Induces the release of cytochrome c, activation of CASP3, and thereby apoptosis. Belongs to the Bcl-2 family. Homodimer. Forms heterodimers with BCL2, E1B 19K protein, BCL2L1 isoform Bcl-X(L), MCL1 and A1. Interacts with SH3GLB1 and HN. Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L). 8 isoforms of the human protein are produced by alternative splicing.
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
Mitochondrion outer membrane>Single-pass membrane protein. Cytoplasm.
Note: Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane.
Cytoplasm.
Cytoplasm.
Cytoplasm.
Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.
Homodimer. Forms higher oligomers under stress conditions. Forms heterooligomers with BAK. Interacts with BCL2L11. Interaction with BCL2L11 promotes BAX oligomerization and association with mitochondrial membranes, with subsequent release of cytochrome c. Forms heterodimers with BCL2, BCL2L1 isoform Bcl-X(L), BCL2L2, MCL1 and A1. Interacts with SH3GLB1 and HN. Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L). Interacts with RNF144B, which regulates the ubiquitin-dependent stability of BAX. Interacts with CLU under stress conditions that cause a conformation change leading to BAX oligomerization and association with mitochondria. Does not interact with CLU in unstressed cells. Interacts with FAIM2/LFG2. Interacts with RTL10/BOP. Interacts (via a C-terminal 33 residues) with NOL3 (via CARD domain); inhibits BAX activation and translocation and consequently cytochrome c release from mitochondria. Interacts with GIMAP3/IAN4 and GIMAP5/IAN5; this interaction is increased, when cells initiate apoptosis upon IL2 withdrawal.
(Microbial infection) Interacts with adenovirus E1B 19K protein; this interaction blocks BAX oligomerization.
(Microbial infection) Interacts with human cytomegalovirus/HHV-5 protein vMIA/UL37.
(Microbial infection) Interacts with enterovirus protein 2B; this interaction activates BAX-induced apoptosis.
Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.
Belongs to the Bcl-2 family.
· Cellular Processes > Cell growth and death > Apoptosis.(View pathway)
· Cellular Processes > Cell growth and death > Apoptosis - multiple species.(View pathway)
· Cellular Processes > Cell growth and death > p53 signaling pathway.(View pathway)
· Cellular Processes > Cell growth and death > Necroptosis.(View pathway)
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.(View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum.(View pathway)
· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).
· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Cancers: Specific types > Melanoma.(View pathway)
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
· Human Diseases > Neurodegenerative diseases > Prion diseases.
· Human Diseases > Cancers: Specific types > Small cell lung cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.(View pathway)
· Human Diseases > Cancers: Specific types > Breast cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Endometrial cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.(View pathway)
· Human Diseases > Cancers: Specific types > Colorectal cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Glioma.(View pathway)
· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Gastric cancer.(View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Thyroid cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Basal cell carcinoma.(View pathway)
· Human Diseases > Cancers: Specific types > Pancreatic cancer.(View pathway)
· Organismal Systems > Aging > Longevity regulating pathway.(View pathway)
· Organismal Systems > Nervous system > Neurotrophin signaling pathway.(View pathway)
Application: WB Species:rat; Sample:Not available
(G-H) Western blot analyses of Bax and Bcl-2 protein expressions in testis homogenates.
Application: WB Species:human; Sample:u87
Cell lysates were electrophoresed and apoptotic proteins were detected by their respective specific antibodies in indicated concentrations. Each bar represents the mean±SEM in triplicate experiments
Application: WB Species:mouse; Sample:Not available
Fig. 2. Effect of olmesartan on podocyte number and apoptosis in diabetic kidneys. A. Kidney sections from control and db/db mice were stained for WT-1 (Wilms tumour protein-1) to determine the podocyte number. Bar = 200 μm. Arrowheads indicate cells which were positively stained. Quantification of glomerular number of WT-1 positive podocytes was shown in the lower panel. B. Western blot analysis of Bax, Bcl-2, and cleaved PARP protein expression in kidneys of control and db/db mice. The ratio of Bax/Bcl-2 was analysed by densitometry
Application: WB Species:rat; Sample:Not available
Figure 7: Validation of differential expression mRNAs and lncRNAs in spinal cord by real time RT-qPCR and Western blot analysis. (A) The differential expression mRNA levels were validated by qRT-PCR. (B) Five upregulated lncRNAs and fve downregulated lncRNAs were validated by qRT-PCR. The levels of mRNAs and lncRNAs were normalized to GAPDH and expressed as fold of change compared to sham group. The results represent the mean± SEM of three independent experiments. *p < 0.05; **p < 0.01 compared with the sham group. Western blot analysis shown protein expression levels of Akt, P-Akt (C), Bcl-2, Caspase-3 (D), P2X7R, S100A9, Bax (E). Each bar represents the mean ± SEM for at least 6 animals.
AF0120-BP
(Blocking peptide available as AF0120-BP)
$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).
Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.
Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
R9 | Methylation | Uniprot | |
S15 | Phosphorylation | Uniprot | |
K21 | Ubiquitination | Uniprot | |
T22 | Phosphorylation | Uniprot | |
K57 | Ubiquitination | Uniprot | |
K58 | Ubiquitination | Uniprot | |
S60 | Phosphorylation | Uniprot | |
K64 | Ubiquitination | Uniprot | |
T85 | Phosphorylation | Uniprot | |
S87 | Phosphorylation | Uniprot | |
T135 | Phosphorylation | Uniprot | |
T140 | Phosphorylation | Uniprot | |
S163 | Phosphorylation | P49841 (GSK3B) | Uniprot |
Y164 | Phosphorylation | Uniprot | |
T167 | Phosphorylation | P27361 (MAPK3) , P28482 (MAPK1) | Uniprot |
T172 | Phosphorylation | Uniprot | |
T174 | Phosphorylation | Uniprot | |
S184 | Phosphorylation | Q05513 (PRKCZ) , P31749 (AKT1) | Uniprot |
T186 | Phosphorylation | Uniprot |