Bax Antibody - AF0120

Price Size
$280 100ul
$350 200ul

Same day delivery

For pricing and ordering contact:

local distributors
  • Product Name
    Bax Antibody
  • Catalog No.
    AF0120
  • RRID
    AB_2833304
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig, Bovine, Horse, Rabbit, Dog
  • UniProt
  • Mol.Wt
    21kD;
    21kDa(Calculated).
  • Concentration
    1mg/ml

  • Browse similar products>>

Related Products

 #AF0120-BP Bax Blocking Peptide $350/1mg

Product Information

Alternative Names:Expand▼

Apoptosis regulator BAX; BAX; Bax-protein; BAX_HUMAN; BAXA; Baxdelta2G9; Baxdelta2G9omega; Baxdelta2omega; Bcl-2-like protein 4; BCL2 associated X protein; BCL2 associated X protein omega; BCL2 associated X protein transcript variant delta2; Bcl2-L-4; BCL2L4; membrane isoform alpha;

Applications:

WB: 1:500-1:3000, IHC: 1:50-1:200, IF/ICC 1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig, Bovine, Horse, Rabbit, Dog

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

Bax Antibody detects endogenous levels of total Bax.

RRID:

AB_2833304
Please cite this product as: Affinity Biosciences Cat# AF0120, RRID:AB_2833304.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human Bax, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

BAX

Molecular Weight:

Observed Mol.Wt.: 21kD.
Predicted Mol.Wt.: 21kDa(Calculated)..

Subcellular Location:

Cytoplasm and Mitochondrion membrane. Cytoplasm. Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane.

Tissue Specificity:

Q07812 BAX_HUMAN:
Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.

Description:

Bax Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Induces the release of cytochrome c, activation of CASP3, and thereby apoptosis. Belongs to the Bcl-2 family. Homodimer. Forms heterodimers with BCL2, E1B 19K protein, BCL2L1 isoform Bcl-X(L), MCL1 and A1. Interacts with SH3GLB1 and HN. Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L). 8 isoforms of the human protein are produced by alternative splicing.

Sequence:
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Research Background

Function:

Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.

Subcellular Location:

Mitochondrion outer membrane>Single-pass membrane protein. Cytoplasm.
Note: Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane.

Cytoplasm.

Cytoplasm.

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.

Subunit Structure:

Homodimer. Forms higher oligomers under stress conditions. Forms heterooligomers with BAK. Interacts with BCL2L11. Interaction with BCL2L11 promotes BAX oligomerization and association with mitochondrial membranes, with subsequent release of cytochrome c. Forms heterodimers with BCL2, BCL2L1 isoform Bcl-X(L), BCL2L2, MCL1 and A1. Interacts with SH3GLB1 and HN. Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L). Interacts with RNF144B, which regulates the ubiquitin-dependent stability of BAX. Interacts with CLU under stress conditions that cause a conformation change leading to BAX oligomerization and association with mitochondria. Does not interact with CLU in unstressed cells. Interacts with FAIM2/LFG2. Interacts with RTL10/BOP. Interacts (via a C-terminal 33 residues) with NOL3 (via CARD domain); inhibits BAX activation and translocation and consequently cytochrome c release from mitochondria. Interacts with GIMAP3/IAN4 and GIMAP5/IAN5; this interaction is increased, when cells initiate apoptosis upon IL2 withdrawal.

(Microbial infection) Interacts with adenovirus E1B 19K protein; this interaction blocks BAX oligomerization.

(Microbial infection) Interacts with human cytomegalovirus/HHV-5 protein vMIA/UL37.

(Microbial infection) Interacts with enterovirus protein 2B; this interaction activates BAX-induced apoptosis.

Similarity:

Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.

Belongs to the Bcl-2 family.

Research Fields

Research Fields:

· Cellular Processes > Cell growth and death > p53 signaling pathway.(View pathway)
· Cellular Processes > Cell growth and death > Apoptosis.(View pathway)
· Cellular Processes > Cell growth and death > Apoptosis - multiple species.(View pathway)
· Cellular Processes > Cell growth and death > Necroptosis.(View pathway)
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.(View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum.(View pathway)
· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.
· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Human Diseases > Neurodegenerative diseases > Prion diseases.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Cancers: Overview > Pathways in cancer.(View pathway)
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Cancers: Specific types > Colorectal cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Pancreatic cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Endometrial cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Glioma.(View pathway)
· Human Diseases > Cancers: Specific types > Thyroid cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Basal cell carcinoma.(View pathway)
· Human Diseases > Cancers: Specific types > Melanoma.(View pathway)
· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.(View pathway)
· Human Diseases > Cancers: Specific types > Small cell lung cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Breast cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.(View pathway)
· Human Diseases > Cancers: Specific types > Gastric cancer.(View pathway)
· Organismal Systems > Aging > Longevity regulating pathway.(View pathway)
· Organismal Systems > Nervous system > Neurotrophin signaling pathway.(View pathway)

Protocols & Troubleshooting

Reference Citations:

1). Li X;Wang J;Gong X;Zhang M;Kang S;Shu B;Wei Z;Huang ZS;Li D; et al. Upregulation of BCL-2 by acridone derivative through gene promoter i-motif for alleviating liver damage of NAFLD/NASH. Nucleic Acids Res 2020 Jul 25;gkaa615. (PubMed: 32710621) [IF=11.501]

Application: WB    Species:human;    Sample:HepG2

Figure 4. Effect of A22 on anti-apoptosis in 0.5 mM palmitic acid oil (PA) induced cell model. (A) Effect of A22 on cell viability for anti-apoptotic protective effect. (B) Effect of A22 on transcription of BCL-2 and BAX with measurement of mRNA levels. (C) Effect of A22 on protein expressions related with apoptosis (left), which were quantitatively analyzed (right). All the experiments were repeated for three times.

2). Hou B;Wang F;Liu T;Wang Z; et al. Reproductive toxicity of polystyrene microplastics: In vivo experimental study on testicular toxicity in mice. J Hazard Mater 2021 Mar 5;405:124028. (PubMed: 33087287) [IF=9.038]
3). Wu H;Hu X;Li Y;Chen Q;Sun T;Qiao Y;Qin W;Wu Z;Fu B;Zhao H;Zhang R;Wei M; et al. LNC473 regulating APAF1 IRES-dependent translation via competitive sponging miR574 and miR15b: Implications in colorectal cancer. Mol Ther Nucleic Acids 2020 Sep 4;21:764-779. (PubMed: 32784109) [IF=7.032]
4). Fan H et al. Bacteroides fragilis Strain ZY-312 Defense against Cronobacter sakazakii-Induced Necrotizing Enterocolitis In Vitro and in a Neonatal Rat Model. mSystems 2019 Aug 6;4(4) (PubMed: 31387931) [IF=6.633]
5). Ma S;Zhu L;Fan X;Luo T;Liu D;Liang Z;Hu X;Shi T;Tan W;Wang Z; et al. Melatonin derivatives combat with inflammation-related cancer by targeting the Main Culprit STAT3. Eur J Med Chem 2021 Feb 5;211:113027. (PubMed: 33248852) [IF=5.572]
6). Zhao M;Chen L;Chen W;Meng Z;Hu K;Du S;Zhang L;Yin L;Wu B;Guan YQ; et al. Packaging cordycepin phycocyanin micelles for the inhibition of brain cancer. J Mater Chem B 2017 Aug 14;5(30):6016-6026. (PubMed: 32264358) [IF=5.344]
7). Wang L et al. Development of anisamide-targeted PEGylated gold nanorods to deliver epirubicin for chemo-photothermal therapy in tumor-bearing mice. Int J Nanomedicine 2019 Mar 8;14:1817-1833 (PubMed: 30880982) [IF=5.115]
8). Yarong Du et al. The Reduced Oligomerization of MAVS Mediated by ROS Enhances the Cellular Radioresistance. OXID MED CELL LONGEV 2020 Mar 4;Article ID 2167129 [IF=5.076]
9). Zhang YH et al. Prostaglandin E1 attenuates high glucose-induced apoptosis in proximal renal tubular cells by inhibiting the JNK/Bim pathway. Acta Pharmacol Sin 2020 Apr;41(4):561-571 (PubMed: 31685975) [IF=5.064]
10). Zhou H et al. Oxidative DNA damage and multi-organ pathologies in male mice subchronically treated with aflatoxin B1. Ecotoxicol Environ Saf 2019 Oct 17;186:109697 (PubMed: 31629905) [IF=4.872]
11). Li S;Lu Y;Ding D;Ma Z;Xing X;Hua X;Xu J; et al. Fibroblast growth factor 2 contributes to the effect of salidroside on dendritic and synaptic plasticity after cerebral ischemia/reperfusion injury. Aging (Albany NY) 2020 Jun 9;12. (PubMed: 32518214) [IF=4.831]
12). Bai HL;Kang CM;Sun ZQ;Li XH;Dai XY;Huang RY;Zhao JJ;Bei YR;Huang XZ;Lu ZF;Wu SG;Lu JB;Ping BH;Wang Q;Hu YW; et al. TTDA inhibited apoptosis by regulating the p53-Bax/Bcl2 axis in glioma. Exp Neurol 2020 Jun 12;113380. (PubMed: 32540359) [IF=4.691]
13). Hong Z;Minghua W;Bo N;Chaoyue Y;Haiyang Y;Haiqing Y;Chunyu X;Yan Z;Yuan Y; et al. Rosmarinic acid attenuates acrylamide induced apoptosis of BRL-3A cells by inhibiting oxidative stress and endoplasmic reticulum stress. Food Chem Toxicol 2021 May;151:112156. (PubMed: 33781805) [IF=4.679]
14). Shi J;Wang S;He Q;Liu K;Zhao W;Xie Q;Cheng L; et al. TNF‐α induces up‐regulation of MicroRNA‐27a via the P38 signalling pathway, which inhibits intervertebral disc degeneration by targeting FSTL1. J Cell Mol Med 2021 Jun 30. (PubMed: 34190406) [IF=4.658]
15). Meng X;Zhang J;Wu H;Yu D;Fang X; et al. Akkermansia muciniphila Aspartic Protease Amuc_1434* Inhibits Human Colorectal Cancer LS174T Cell Viability via TRAIL-Mediated Apoptosis Pathway. Int J Mol Sci 2020 May 11;21(9):E3385. (PubMed: 32403433) [IF=4.556]
16). Yu Z;Li Q;Wang Y;Li P; et al. A Potent Protective Effect of Baicalein on Liver Injury by Regulating Mitochondria-Related Apoptosis. Apoptosis 2020 May 14. (PubMed: 32409930) [IF=4.543]
17). Liu H et al. Long non-coding RNA MALAT1 mediates hypoxia-induced pro-survival autophagy of endometrial stromal cells in endometriosis. J Cell Mol Med 2019 Jan;23(1):439-452 (PubMed: 30324652) [IF=4.486]
18). Liu H et al. Long non-coding RNA MALAT1 mediates hypoxia-induced pro-survival autophagy of endometrial stromal cells in endometriosis. J Cell Mol Med 2019 Jan;23(1):439-452 (PubMed: 30324652) [IF=4.486]
19). Shi J;Wang S;He Q;Liu K;Zhao W;Xie Q;Cheng L; et al. TNF‐α induces up‐regulation of MicroRNA‐27a via the P38 signalling pathway, which inhibits intervertebral disc degeneration by targeting FSTL1. J Cell Mol Med 2021 Jun 30. (PubMed: 34190406) [IF=4.486]
20). Wang N;Xu P;Wang X;Yao W;Wang B;Wu Y;Shou D; et al. Timosaponin AIII attenuates inflammatory injury in AGEs-induced osteoblast and alloxan-induced diabetic osteoporosis zebrafish by modulating the RAGE/MAPK signaling pathways. Phytomedicine 2020 May 24;75:153247. (PubMed: 32502823) [IF=4.268]
21). Chen G;Xu H;Wu Y;Han X;Xie L;Zhang G;Liu B;Zhou Y; et al. Myricetin suppresses the proliferation and migration of vascular smooth muscle cells and inhibits neointimal hyperplasia via suppressing TGFBR1 signaling pathways. Phytomedicine 2021 Nov;92:153719. (PubMed: 34500301) [IF=4.268]
22). Tian Q et al. Phosphoprotein Gene Contributes to the Enhanced Apoptosis Induced by Wild-Type Rabies Virus GD-SH-01 In Vitro. Front Microbiol 2017 Sep 5;8:1697 (PubMed: 28928726) [IF=4.235]

Application: WB    Species:mouse;    Sample:Not available

23). Zhu H et al. Synthesis of Chalcone Derivatives: Inducing Apoptosis of HepG2 Cells via Regulating Reactive Oxygen Species and Mitochondrial Pathway. Front Pharmacol 2019 Nov 15;10:1341 (PubMed: 31803052) [IF=4.225]
24). Wu YT;Xie LP;Hua Y;Xu HL;Chen GH;Han X;Tan ZB;Fan HJ;Chen HM;Li J;Liu B;Zhou YC; et al. Tanshinone I Inhibits Oxidative Stress–Induced Cardiomyocyte Injury by Modulating Nrf2 Signaling. Front Pharmacol 2021 May 18;12:644116. (PubMed: 34084132) [IF=4.225]
25). Zhou NQ;Fang ZX;Huang N;Zuo Y;Qiu Y;Guo LJ;Song P;Xu J;Wan GR;Tian XQ;Yin YL;Li P; et al. aFGF Targeted Mediated by Novel Nanoparticles-Microbubble Complex Combined With Ultrasound-Targeted Microbubble Destruction attenuates Doxorubicin-Induced Heart Failure via Anti-Apoptosis and Promoting Cardiac Angiogenesis. Front Pharmacol 2021 Apr 27;12:607785. (PubMed: 33986662) [IF=4.225]
26). Liu Y et al. Oligo-Porphyran Ameliorates Neurobehavioral Deficits in Parkinsonian Mice by Regulating the PI3K/Akt/Bcl-2 Pathway. Mar Drugs 2018 Mar 6;16(3) (PubMed: 29509717) [IF=4.073]
27). Wang M et al. Long Non-Coding RNA MEG3 Promotes Apoptosis of Vascular Cells and is Associated with Poor Prognosis in Ischemic Stroke. J Atheroscler Thromb 2019 Oct 25 (PubMed: 31656272) [IF=3.876]
28). Lu Q et al. The mTOR promotes oxidative stress-induced apoptosis of mesangial cells in diabetic nephropathy. Mol Cell Endocrinol 2018 Sep 15;473:31-43 (PubMed: 29277549) [IF=3.871]
29). Zhai Z et al. Andrographolide prevents human breast cancer-induced osteoclastic bone loss via attenuated RANKL signaling. Breast Cancer Res Treat 2014 Feb;144(1):33-45 (PubMed: 24481680) [IF=3.831]
30). Cheng J;Song Y;Xu J;Li HH;Zheng JF; et al. LncRNA PVT1 promotes the malignant progression of acute myeloid leukaemia via sponging miR-29 family to increase WAVE1 expression. Pathology 2021 Feb 6;S0031-3025(21)00021-0. (PubMed: 33558065) [IF=3.744]
31). Zheng Z;Bian Y;Zhang Y;Ren G;Li G; et al. Metformin activates AMPK/SIRT1/NF-κB pathway and induces mitochondrial dysfunction to drive caspase3/GSDME-mediated cancer cell pyroptosis. Cell Cycle 2020 May;19(10):1089-1104. (PubMed: 32286137) [IF=3.699]
32). Chen Y et al. Iridoid glycoside from Cornus officinalis ameliorated diabetes mellitus-induced testicular damage in male rats: Involvement of suppression of the AGEs/RAGE/p38 MAPK signaling pathway. J Ethnopharmacol 2016 Dec 24;194:850-860 (PubMed: 27989876) [IF=3.690]

Application: WB    Species:rat;    Sample:Not available

(G-H) Western blot analyses of Bax and Bcl-2 protein expressions in testis homogenates.

33). Yang Q et al. Yinning Tablet, a hospitalized preparation of Chinese herbal formula for hyperthyroidism, ameliorates thyroid hormone-induced liver injury in rats: Regulation of mitochondria-mediated apoptotic signals. J Ethnopharmacol 2020 Jan 28;252:112602 (PubMed: 32004632) [IF=3.690]
34). Zhou J et al. MicroRNA-145 overexpression attenuates apoptosis and increases matrix synthesis in nucleus pulposus cells. Life Sci 2019 Feb 20 (PubMed: 30797016) [IF=3.647]
35). Li F et al. Icariin improves the cognitive function of APP/PS1 mice via suppressing endoplasmic reticulum stress. Life Sci 2019 Aug 7:116739 (PubMed: 31400352) [IF=3.647]
36). Li X;Zhou B;Han X;Liu H; et al. Effect of nicotine on placental inflammation and apoptosis in preeclampsia-like model. Life Sci 2020 Aug 21;118314. (PubMed: 32835699) [IF=3.647]
37). Zhao ZH et al. PirB Overexpression Exacerbates Neuronal Apoptosis by Inhibiting TrkB and mTOR Phosphorylation After Oxygen and Glucose Deprivation Injury. Cell Mol Neurobiol 2017 May;37(4):707-715 (PubMed: 27443384) [IF=3.606]

Application: WB    Species:mouse;    Sample:Not available

38). Tu X et al. Pretreatment of Grape Seed Proanthocyanidin Extract Exerts Neuroprotective Effect in Murine Model of Neonatal Hypoxic-ischemic Brain Injury by Its Antiapoptotic Property. Cell Mol Neurobiol 2019 May 30 (PubMed: 31147852) [IF=3.606]
39). Liu X;Qiu Y;Liu Y;Huang N;Hua C;Wang Q;Wu Z;Lu J;Song P;Xu J;Li P;Yin Y; et al. Citronellal ameliorates doxorubicin‐induced hepatotoxicity via antioxidative stress, antiapoptosis, and proangiogenesis in rats. J Biochem Mol Toxicol 2021 Feb;35(2):e22639. (PubMed: 33051984) [IF=3.606]
40). Li M;Liu P;Xue Y;Liang Y;Shi J;Han X;Zhang J;Chu X;Chu L; et al. Tannic acid attenuates hepatic oxidative stress, apoptosis and inflammation by activating the Keap1‑Nrf2/ARE signaling pathway in arsenic trioxide‑toxicated rats. Oncol Rep 2020 Nov;44(5):2306-2316. (PubMed: 33000240) [IF=3.417]
41). Wei X;Xu L;Jeddo SF;Li K;Li X;Li J; et al. MARK2 enhances cisplatin resistance via PI3K/AKT/NF-κB signaling pathway in osteosarcoma cells. Am J Transl Res 2020 May 15;12(5):1807-1823. (PubMed: 32509178) [IF=3.375]
42). Lei H;Ma Y;Tan J;Liu Q; et al. Helicobacter pylori Regulates the Apoptosis of Human Megakaryocyte Cells via NF-κB/IL-17 Signaling. Onco Targets Ther 2021 Mar 19;14:2065-2074. (PubMed: 33776453) [IF=3.337]
43). Lu T;Ma K;Zhan C;Yang X;Shi Y;Jiang W;Wang H;Wang S;Wang Q;Tan L; et al. Downregulation of long non-coding RNA LINP1 inhibits the malignant progression of esophageal squamous cell carcinoma. Ann Transl Med 2020 Jun;8(11):675. (PubMed: 32617295) [IF=3.297]
44). Jiang W et al. Inhibiting PKCβ2 protects HK-2 cells against meglumine diatrizoate and AGEs-induced apoptosis and autophagy. Ann Transl Med 2020 Mar;8(6):293 (PubMed: 32355737) [IF=3.297]
45). Zhang W;Du Q;Bian P;Xiao Z;Wang X;Feng Y;Feng H;Zhu Z;Gao N;Zhu D;Fan X;Zhu Y; et al. Artesunate exerts anti-prolactinoma activity by inhibiting mitochondrial metabolism and inducing apoptosis. Ann Transl Med 2020 Jul;8(14):858. (PubMed: 32793702) [IF=3.297]
46). Feng SH;Zhao B;Zhan X;Motanyane R;Wang SM;Li A; et al. Danggui Buxue Decoction in the Treatment of Metastatic Colon Cancer: Network Pharmacology Analysis and Experimental Validation. Drug Des Devel Ther 2021 Feb 24;15:705-720. (PubMed: 33658761) [IF=3.216]
47). Li A et al. NUPR1 Silencing Induces Autophagy-Mediated Apoptosis in Multiple Myeloma Cells Through the PI3K/AKT/mTOR Pathway. DNA Cell Biol 2020 Jan 22 (PubMed: 31971825) [IF=3.191]
48). Zhou Y et al. Combination Therapy With Hyperbaric Oxygen and Erythropoietin Inhibits Neuronal Apoptosis and Improves Recovery in Rats With Spinal Cord Injury. Phys Ther 2019 Sep 2 (PubMed: 31504911) [IF=3.140]
49). Hu L et al. Tri-ortho-cresyl phosphate (TOCP) induced ovarian failure in mice is related to the Hippo signaling pathway disruption. Reprod Toxicol 2018 Nov 12 (PubMed: 30439503) [IF=3.121]
50). Liao ZL et al. Salidroside protects PC-12 cells against amyloid β-induced apoptosis by activation of the ERK1/2 and AKT signaling pathways. Int J Mol Med 2019 Feb 1 (PubMed: 30720058) [IF=3.098]
51). He Y;Shi Y;Huang H;Feng Y;Wang Y;Zhan L;Wei B; et al. Chrysin induces autophagy through the inactivation of the ROS‑mediated Akt/mTOR signaling pathway in endometrial cancer. Int J Mol Med 2021 Sep;48(3):172. (PubMed: 34278450) [IF=3.098]
52). Liu YL;Yang WH;Chen BY;Nie J;Su ZR;Zheng JN;Gong ST;Chen JN;Jiang D;Li Y; et al. miR‑29b suppresses proliferation and induces apoptosis of hepatocellular carcinoma ascites H22 cells via regulating TGF‑β1 and p53 signaling pathway. Int J Mol Med 2021 Aug;48(2):157. (PubMed: 34184070) [IF=3.098]
53). Sun F;Zhang J;Chen L;Yuan Y;Guo X;Dong L;Sun J; et al. Epac1 signaling pathway mediates the damage and apoptosis of inner ear hair cells after noise exposure in a rat model. Neuroscience 2021 Apr 7;S0306-4522(21)00168-8. (PubMed: 33838290) [IF=3.056]
54). Liu Y et al. Fucoxanthin Activates Apoptosis via Inhibition of PI3K/Akt/mTOR Pathway and Suppresses Invasion and Migration by Restriction of p38-MMP-2/9 Pathway in Human Glioblastoma Cells. Neurochem Res 2016 Oct;41(10):2728-2751 (PubMed: 27394418) [IF=3.038]

Application: WB    Species:human;    Sample:u87

Cell lysates were electrophoresed and apoptotic proteins were detected by their respective specific antibodies in indicated concentrations. Each bar represents the mean±SEM in triplicate experiments

55). Luo HM et al. Calcitonin gene-related peptide attenuates angiotensin II-induced ROS-dependent apoptosis in vascular smooth muscle cells by inhibiting the CaMKII/CREB signalling pathway. Biochem Biophys Res Commun 2019 Oct 23 (PubMed: 31668374)
56). Shao Q et al. MicroRNA-139-5p affects cisplatin sensitivity in human nasopharyngeal carcinoma cells by regulating the epithelial-to-mesenchymal transition. Gene 2018 Apr 30;652:48-58 (PubMed: 29427737)
57). Chen W et al. MicroRNA-214 protects L6 skeletal myoblasts against hydrogen peroxide-induced apoptosis. Free Radic Res 2020 Mar 5:1-11 (PubMed: 32131653)
58). Zhou F;Feng T;Lu X;Wang H;Chen Y;Zhang Q;Zhang X;Xiu J; et al. Interleukin 35 protects cardiomyocytes following ischemia/reperfusion-induced apoptosis via activation of mitochondrial STAT3. Acta Biochim Biophys Sin (Shanghai) 2021 Feb 23;gmab007. (PubMed: 33619515)
59). Zhao H;Zhou D;Chen Y;Liu D;Chu S;Zhang S; et al. Protective Effects of Berberine on Rat Model of Polycystic Ovary Syndrome Through the PI3K/AKT Pathway. Daru 2017 Oct 11;25(1):21. (PubMed: 29020999)
60). Xu G;Li X;Zhu Z;Wang H;Bai X; et al. Iron Overload Induces Apoptosis and Cytoprotective Autophagy Regulated by ROS Generation in Mc3t3-E1 Cells. Biol Trace Elem Res 2021 Jan 6. (PubMed: 33405076)
61). Zhou Y et al. Altered Light Conditions Contribute to Abnormalities in Emotion and Cognition Through HINT1 Dysfunction in C57BL/6 Mice. Front Behav Neurosci 2018 Jun 8;12:110 (PubMed: 29937721)
62). Wu CJ;Fu FD;Qin F;Ma M;Li T;Wei SZ;Yu BT;Yang XZ;Yuan JH; et al. Vacuum therapy ameliorates erectile dysfunction in bilateral cavernous nerve crush rats by inhibiting apoptosis and activating autophagy. Asian J Androl May-Jun 2021;23(3):273-280. (PubMed: 33473012)
63). Li R et al. Curcumin ameliorates atrophy of seminal vesicle via reduction of oxidative stress in castrated mice. PeerJ 2019 Jul 5;7:e7192 (PubMed: 31316871)
64). Liu Y;Wang S;Zhou R;Li W;Zhang G; et al. Overexpression of E74‑like transformation‑specific transcription factor 3 promotes cellular proliferation and predicts poor prognosis in ovarian cancer. Oncol Lett 2021 Oct;22(4):710. (PubMed: 34457065)
65). Li A;Chen X;Jing Z;Chen J; et al. Trifluoperazine induces cellular apoptosis by inhibiting autophagy and targeting NUPR1 in multiple myeloma. FEBS Open Bio 2020 Aug 18. (PubMed: 32810364)
66). Shang J et al. CircPAN3 contributes to drug resistance in acute myeloid leukemia through regulation of autophagy. Leuk Res 2019 Aug 2;85:106198 (PubMed: 31401408)
67). Zhang SH et al. Ferulic acid ameliorates pentylenetetrazol-induced seizures by reducing neuron cell death. Epilepsy Res 2019 Aug 5;156:106183 (PubMed: 31404716)
68). Ding Y;Zhang H;Liu Z;Li Q;Guo Y;Chen Y;Chang Y;Cui H; et al. Carnitine palmitoyltransferase 1 (CPT1) alleviates oxidative stress and apoptosis of hippocampal neuron in response to beta-Amyloid peptide fragment Aβ25-35. Bioengineered 2021 Dec;12(1):5440-5449. (PubMed: 34424821)
69). Wang JY;Nie YX;Dong BZ;Cai ZC;Zeng XK;Du L;Zhu X;Yin XX; et al. Quercetin protects islet β-cells from oxidation-induced apoptosis via Sirt3 in T2DM. Iran J Basic Med Sci 2021 May;24(5):629-635. (PubMed: 34249264)
70). Zhang W;Huang J;Tang Y;Yang Y;Hu H; et al. Inhibition of Fatty Acid Synthase (FASN) Affects the Proliferation and Apoptosis of HepG2 Hepatoma Carcinoma Cells via the β-catenin/C-myc Signaling Pathway. Ann Hepatol 2020 Mar 31;S1665-2681(20)30027-2. (PubMed: 32536483)
71). Zhang S;Zhao J;Ma W; et al. Circ-Sirt1 inhibits proliferation, induces apoptosis, and ameliorates inflammation in human rheumatoid arthritis fibroblast-like synoviocytes. Autoimmunity 2021 Aug 25;1-12. (PubMed: 34431434)
72). Mi L et al. ACSS2/AMPK/PCNA pathway‑driven proliferation and chemoresistance of esophageal squamous carcinoma cells under nutrient stress. Mol Med Rep 2019 Dec;20(6):5286-5296 (PubMed: 31638228)
73). Li Y et al. Theaflavic acid from black tea protects PC12 cells against ROS-mediated mitochondrial apoptosis induced by OGD/R via activating Nrf2/ARE signaling pathway. J Nat Med 2019 Jun 21 (PubMed: 31227974)
74). Su S;Lu W;Liu J;Li L;Liu L;Li X;Ye D;Yu Z; et al. Circ_0007031 Silencing Inhibits Cell Proliferation and Induces Cell Apoptosis via Downregulating MELK at a miR-485-3p-Dependent Way in Colorectal Cancer. Biochem Genet 2021 Jul 28. (PubMed: 34322757)
75). Zhao J;Han Y;Wang Z;Zhang R;Wang G;Mao Y; et al. Alginate oligosaccharide protects endothelial cells against oxidative stress injury via integrin-α/FAK/PI3K signaling. Biotechnol Lett 2020 Sep 28. (PubMed: 32986180)
76). Gu J et al. Olmesartan Prevents Microalbuminuria in db/db Diabetic Mice Through Inhibition of Angiotensin II/p38/SIRT1-Induced Podocyte Apoptosis. Kidney Blood Press Res 2016;41(6):848-864 (PubMed: 27871084)

Application: WB    Species:mouse;    Sample:Not available

Fig. 2. Effect of olmesartan on podocyte number and apoptosis in diabetic kidneys. A. Kidney sections from control and db/db mice were stained for WT-1 (Wilms tumour protein-1) to determine the podocyte number. Bar = 200 μm. Arrowheads indicate cells which were positively stained. Quantification of glomerular number of WT-1 positive podocytes was shown in the lower panel. B. Western blot analysis of Bax, Bcl-2, and cleaved PARP protein expression in kidneys of control and db/db mice. The ratio of Bax/Bcl-2 was analysed by densitometry

77). Kan J;Huang H;Jiang Z;Zhou R;Bai S;Liao C;Chen J;Dong J;Zhang Y;Zhang J;Zhang R;Zhou D;Zhang E; et al. Arenobufagin Promoted Oxidative Stress-Associated Mitochondrial Pathway Apoptosis in A549 Non-Small-Cell Lung Cancer Cell Line. Evid Based Complement Alternat Med 2020 Apr 22;2020:8909171. (PubMed: 32382311)
78). Zhang W et al. MicroRNA-124 expression in the brains of rats during early cerebral ischemia and reperfusion injury is associated with cell apoptosis involving STAT3. Exp Ther Med 2019 Apr;17(4):2870-2876 (PubMed: 30906474)
79). Zhang W et al. MicroRNA-124 expression in the brains of rats during early cerebral ischemia and reperfusion injury is associated with cell apoptosis involving STAT3. Exp Ther Med 2019 Apr;17(4):2870-2876 (PubMed: 30906474)
80). Liu J;Xu H;Wang N;Sun M; et al. miR‑15b, a diagnostic biomarker and therapeutic target, inhibits oesophageal cancer progression by regulating the PI3K/AKT signalling pathway. Exp Ther Med 2020 Dec;20(6):222. (PubMed: 33363587)
81). Zhang Y;Ding S;Chen Y;Sun Z;Zhang J;Han Y;Dong X;Fang Z;Li W; et al. Ginsenoside Rg1 alleviates lipopolysaccharide‑induced neuronal damage by inhibiting NLRP1 inflammasomes in HT22 cells. Exp Ther Med 2021 Jul;22(1):782. (PubMed: 34055081)
82). Chen X;Huang J; et al. Mangiferin inhibits hypoxia/reoxygenation‑induced alveolar epithelial cell injury via the SIRT1/AMPK signaling pathway. Exp Ther Med 2021 Nov;22(5):1220. (PubMed: 34603517)
83). Huankai Yao et al. Protective effects of hederagenic acid on PC12 cells against the OGD/R-induced apoptosis via activating Nrf2/ARE signaling pathway. Med Chem Res 2020 Jan
84). He J;He L;Lu F;Geng B;Xia Y; et al. Low-molecular-weight heparin calcium attenuates the tourniquet-induced ischemia-reperfusion injury in rats. Injury 2021 Mar 5;S0020-1383(21)00221-7. (PubMed: 33726921)
85). Xing F;Liu Y;Dong R;Cheng Y; et al. miR-374 improves cerebral ischemia reperfusion injury by targeting Wnt5a. Exp Anim 2020 Oct 27. (PubMed: 33116025)
86). Jiang S;Zhang QA;Guo Q;Di Z; et al. The glutamatergic system and astrocytic impairment in rat hippocampus: a comparative study of underlying etiology and pathophysiology of depression. J Integr Neurosci 2019 Dec 30;18(4):387-392. (PubMed: 31912696)
87). Wang H et al. Baicalin extracted from Huangqin (Radix Scutellariae Baicalensis) induces apoptosis in gastric cancer cells by regulating B cell lymphoma(Bcl-2)/Bcl-2-associated X protein and activating caspase-3 and caspase-9. J Tradit Chin Med 2017 Apr;37(2):229-5 (PubMed: 29960296)
88). et al. Effects of Sancai Lianmei Particle on autophagy and apoptosis in testes of diabetic mice via the Nrf2/HO-1 pathway. Int J Clin Exp Med 2019;12(6):6720-6732
89). Liu QQ et al. Differential gene and lncRNA expression in the lower thoracic spinal cord following ischemia/reperfusion-induced acute kidney injury in rats. Oncotarget 2017 Jun 20;8(32):53465-53481 (PubMed: 28881824)

Application: WB    Species:rat;    Sample:Not available

Figure 7: Validation of differential expression mRNAs and lncRNAs in spinal cord by real time RT-qPCR and Western blot analysis. (A) The differential expression mRNA levels were validated by qRT-PCR. (B) Five upregulated lncRNAs and fve downregulated lncRNAs were validated by qRT-PCR. The levels of mRNAs and lncRNAs were normalized to GAPDH and expressed as fold of change compared to sham group. The results represent the mean± SEM of three independent experiments. *p < 0.05; **p < 0.01 compared with the sham group. Western blot analysis shown protein expression levels of Akt, P-Akt (C), Bcl-2, Caspase-3 (D), P2X7R, S100A9, Bax (E). Each bar represents the mean ± SEM for at least 6 animals.

90). Xiangli Yan et al. Calycosin-7-O-β-D-glucoside Attenuates OGD/R-Induced Damage by Preventing Oxidative Stress and Neuronal Apoptosis via the SIRT1/FOXO1/PGC-1α Pathway in HT22 Cells. NEURAL PLAST 2019, Article ID 8798069, 11 pages
91). Zhao H;Zhou D;Chen Y;Liu D;Chu S;Zhang S; et al. Protective Effects of Berberine on Rat Model of Polycystic Ovary Syndrome Through the PI3K/AKT Pathway. Daru 2017 Oct 11;25(1):21. (PubMed: 29020999)
92). Wang T;Lu H;Li D;Huang W; et al. TGF-β1-Mediated Activation of SERPINE1 is Involved in Hemin-Induced Apoptotic and Inflammatory Injury in HT22 Cells. Neuropsychiatr Dis Treat 2021 Feb 11;17:423-433. (PubMed: 33603380)
93). et al. Effects and Mechanisms of Vitamin C Post-Conditioning on Platelet Activation after Hypoxia/Reoxygenation.
94). Gong L;He J;Sun X;Li L;Zhang X;Gan H; et al. Activation of sirtuin1 protects against ischemia/reperfusion-induced acute kidney injury. Biomed Pharmacother 2020 May;125:110021. (PubMed: 32092826)
95). et al. Regulation of RUNX3 expression by DNA methylation in prostate cancer.
96). et al. The role of Apatinib combined with Paclitaxel (aluminum binding type) in drug-resistant ovarian cancer.
97). et al. Ginsenoside Rg1 protects against aging-induced renal interstitial fibrosis due to inhibition of tubular epithelial cells endoplasmic reticulum stress in SAMP8 mice.
98). et al. The Role of Apatinib Combined with Paclitaxel (aluminum binding type) in Platinumresistant Ovarian Cancer.
99). et al. Bone Marrow Mesenchymal Stem Cells-Derived Exosomes Promote Osteoporosis and Osteoblast Proliferation by Inhibiting Bax/Bcl-2/Caspase Signaling Pathway.
100). et al. Effects of miR-155 on High Glucose Induced-Cardiac Developmental Defects of Zebrafish Embryos.
101). Zhang Y;Chen Y;Li B;Ding P;Jin D;Hou S;Cai X;Sheng X; et al. The effect of monotropein on alleviating cisplatin-induced acute kidney injury by inhibiting oxidative damage, inflammation and apoptosis. Biomed Pharmacother 2020 Jun 20;129:110408. (PubMed: 32574971)
102). et al. Depletion of Fractalkine Ameliorates Renal Injury and Treg Cell Apoptosis Via the p38MAPK Pathway in Lupus-prone Mice.
103). et al. Tannic Acid Alleviates Lipopolysaccharide-Induced H9C2 Cell Apoptosis by Suppressing ROS-Mediated ER Stress.
104). et al. CP-25 ameliorates methotrexate induced nephrotoxicity via improving renal apoptosis and methotrexate excretion.
105). et al. Quercetin protects islet β‑cells from oxidation-induced apoptosis via Sirt3 in T2DM.
106). Sun XL;Zhang JB;Guo YX;Xia TS;Xu LC;Rahmand K;Wang GP;Li XJ;Han T;Wang NN;Xin HL; et al. Xanthohumol ameliorates memory impairment and reduces the deposition of β-amyloid in APP/PS1 mice via regulating the mTOR/LC3II and Bax/Bcl-2 signalling pathways. J Pharm Pharmacol 2021 Apr 28;rgab052. (PubMed: 33909081)
107). et al. Tannic acid alleviates lipopolysaccharide‑induced H9C2 cell apoptosis by suppressing reactive oxygen species‑mediated endoplasmic reticulum stress.
108). et al. HINT1 is involved in the chronic mild stress elicited oxidative stress and apoptosis through the PKC ε/ALDH-2/4HNE pathway in prefrontal cortex of rats.
109). et al. Long non‑coding RNA B3GALT5‑AS1 contributes to the progression of gastric cancer via interacting with CSNK2A1.
110). et al. Rapamycin Attenuated Podocyte Apoptosis Via Upregulation of Nestin in Ang II-Induced Podocyte Injury.
111). et al. Leonurine Ameliorates Oxidative Stress and Insufficient Angiogenesis by Regulating the PI3K/Akt-eNOS Signaling Pathway in H2O2-Induced HUVECs.
112). et al. Hydrogen (H2) Alleviates Osteoarthritis by Inhibiting Apoptosis and Inflammation via the JNK Signaling Pathway.
113). et al. MicroRNA‑590‑3p relieves hypoxia/reoxygenation induced cardiomyocytes apoptosis and autophagy by targeting HIF‑1α.
114). et al. Mst2 Overexpression Inhibits Thyroid Carcinoma Growth and Metastasis by Disrupting Mitochondrial Fitness and Endoplasmic Reticulum Homeostasis.
115). et al. Anti-Tumor Activity and Mechanism of Gemcitabine Derivative SZY-200 Assembled from Gemcitabine-Lauric Acid Conjugate on Human Bladder Cancer Cells.
116). et al. Keratin 80 regulated by miR-206/ETS1 promotes tumor progression via the MEK/ERK pathway in ovarian cancer.
117). et al. Downregulation of miR-128 Ameliorates Ang II-Induced Cardiac Remodeling via SIRT1/PIK3R1 Multiple Targets.
118). Chen Y;Zhang H;Ji S;Jia P;Chen Y;Li Y;Wang T; et al. Resveratrol and its derivative pterostilbene attenuate oxidative stress-induced intestinal injury by improving mitochondrial redox homeostasis and function via SIRT1 signaling. Free Radic Biol Med 2021 Oct 12;177:1-14. (PubMed: 34648904)
119). et al. Anti-Tumor Activity and Mechanism of Gemcitabine Derivative SZY-200 Assembled from GemcitabineLauric Acid Conjugate on Human Bladder Cancer Cells.
No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF0120-BP
(Blocking peptide available as AF0120-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide（0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Horse
100%
Bovine
100%
Dog
100%
Rabbit
100%
Xenopus
70%
Sheep
0%
Zebrafish
0%
Chicken
0%
High similarity Medium similarity Low similarity No similarity
Q07812 as Substrate
Site PTM Type Enzyme
M1 Acetylation
R9 Methylation
S15 Phosphorylation
K21 Ubiquitination
T22 Phosphorylation
K57 Ubiquitination
K58 Ubiquitination
S60 Phosphorylation
K64 Ubiquitination
T85 Phosphorylation
S87 Phosphorylation
T135 Phosphorylation
T140 Phosphorylation
S163 Phosphorylation P49841 (GSK3B)
Y164 Phosphorylation
T167 Phosphorylation P27361 (MAPK3) , P28482 (MAPK1)
T172 Phosphorylation
T174 Phosphorylation
S184 Phosphorylation Q05513 (PRKCZ) , P31749 (AKT1)
T186 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top