Price Size
$280 100ul
$350 200ul

Same day delivery

Contact distributor
  • Product Name
    SOD2/MnSOD Antibody
  • Catalog No.
    AF5144
  • RRID
    AB_2837630
  • Source
    Rabbit
  • Application
    WB,IHC,ELISA
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Xenopus(100%)
  • UniProt
  • Mol.Wt
    25kD;
    25kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

Indophenoloxidase B; IPO B; IPOB; Manganese containing superoxide dismutase; Manganese SOD; Manganese superoxide dismutase; Mangano superoxide dismutase; Mn SOD; Mn superoxide dismutase; MNSOD; MVCD6; SOD 2; SOD2; SODM_HUMAN; Superoxide dismutase [Mn] mitochondrial; Superoxide dismutase [Mn], mitochondrial; Superoxide dismutase 2 mitochondrial;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Xenopus(100%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

SOD2/MnSOD Antibody detects endogenous levels of total SOD2/MnSOD.

RRID:

AB_2837630
Please cite this product as: Affinity Biosciences Cat# AF5144, RRID:AB_2837630.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

A synthesized peptide derived from human SOD2/MnSOD, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

SOD2

Molecular Weight:

Observed Mol.Wt.: 25kD.
Predicted Mol.Wt.: 25kDa(Calculated)..

Subcellular Location:

Mitochondrion matrix.

Description:

Mn SOD antibody Mn superoxide dismutase antibody MNSOD antibody MVCD6 antibody SOD 2 antibody SOD2 antibody SODM_HUMAN antibody

Sequence:
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Research Background

Function:

Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.

Post-translational Modifications:

Nitrated under oxidative stress. Nitration coupled with oxidation inhibits the catalytic activity.

Acetylation at Lys-122 decreases enzymatic activity. Deacetylated by SIRT3 upon exposure to ionizing radiations or after long fasting (By similarity).

Polyubiquitinated; leading to proteasomal degradation. Deubiquitinated by USP36 which increases protein stability.

Subcellular Location:

Mitochondrion matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Subunit Structure:

Homotetramer.

Similarity:

Belongs to the iron/manganese superoxide dismutase family.

Research Fields

Research Fields:

· Cellular Processes > Transport and catabolism > Peroxisome.(View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway.(View pathway)
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Organismal Systems > Aging > Longevity regulating pathway.(View pathway)
· Organismal Systems > Aging > Longevity regulating pathway - multiple species.(View pathway)

Reference Citations:

1). Li X;Leng Y;Li X;Wang Y;Luo P;Zhang C;Wang Z;Yue X;Shen C;Chen L;Liu Z;Shi C;Xie L; et al. The TβR II-targeted aptamer S58 prevents fibrosis after glaucoma filtration surgery. Aging (Albany NY) 2020 May 23;12(10):8837-8857. (PubMed: 32452828) [IF=4.831]

2). Wu M et al. Resveratrol delays polycystic kidney disease progression through attenuation of nuclear factor κB-induced inflammation. Nephrol Dial Transplant 2016 Nov;31(11):1826-1834 (PubMed: 27190325) [IF=4.531]

Application: WB    Species:rat;    Sample:Not available

FIGURE 3: Pro-inflammatory factors, anti-oxidant enzyme and cell signaling pathways in resveratrol (Res)- or vehicle-treated cystic kidneys. (A) TNF-α, MCP-1, CFB and SOD2 were analyzed by western blot in 9-week-old +/+ and Cy/+ kidneys. (B–E) Immunohistochemical staining for oxidative stress markers 8-OHdG and nitrotyrosine in the tubulointerstitial area. Computer-assisted morphometry was used to quantify changes of 8-OHdG and nitrotyrosine in each group. Scale bar = 50 µm. (F) NF-κB pathway ( p-p65, p65, p105 and p50) and mTOR pathway ( p-S6K and total S6K) were analyzed by western blot in 9-week-old +/+ and Cy/+ kidneys. Blots are representative of three independent experiments.


3). Qiu H et al. DL-3-n-butylphthalide improves ventricular function, and prevents ventricular remodeling and arrhythmias in post-MI rats. Naunyn Schmiedebergs Arch Pharmacol 2018 Jun;391(6):627-637 (PubMed: 29602954)

4). Sun H et al. Role of 5-HT1A receptor in insular cortex mediating stress - induced visceral sensory dysfunction. Neurogastroenterol Motil 2016 Jul;28(7):1104-13 (PubMed: 26969829)

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF5144-BP
(Blocking peptide available as AF5144-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Xenopus
100%
Zebrafish
100%
Pig
100%
Sheep
100%
Horse
100%
Bovine
100%
Rabbit
100%
Dog
0%
Chicken
0%
High similarity Medium similarity Low similarity No similarity
P04179 as Substrate
Site PTM Type Enzyme
K53 Acetylation
Y58 Phosphorylation
K68 Acetylation
T79 Phosphorylation
S106 Phosphorylation P06493 (CDK1) , P11802 (CDK4)
K122 Acetylation
K122 Ubiquitination
S127 Phosphorylation
K130 Acetylation
K130 Methylation
K130 Ubiquitination
K132 Acetylation
K221 Acetylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top