Price Size
$280 100ul
$350 200ul

Same day delivery

Contact distributor
  • Product Name
    VEGFA Antibody
  • Catalog No.
    AF5131
  • RRID
    AB_2837617
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig(100%), Bovine(89%), Horse(89%), Sheep(90%), Rabbit(100%), Dog(100%)
  • UniProt
  • Mol.Wt
    (Observed)16-20kD,25-30kD,40-45kD; (Calculated)27kDa
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

Folliculostellate cell-derived growth factor; Glioma-derived endothelial cell mitogen; MGC70609; MVCD1; Vascular endothelial growth factor A; vascular endothelial growth factor A121; vascular endothelial growth factor A165; vascular endothelial growth factor; Vascular permeability factor; VEGF A; Vegf; VEGF-A; VEGF120; Vegfa; VEGFA_HUMAN; VPF;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig(100%), Bovine(89%), Horse(89%), Sheep(90%), Rabbit(100%), Dog(100%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

VEGFA Antibody detects endogenous levels of total VEGFA.

RRID:

AB_2837617
Please cite this product as: Affinity Biosciences Cat# AF5131, RRID:AB_2837617.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

A synthesized peptide derived from human VEGFA, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

VEGFA

Molecular Weight:

Observed Mol.Wt.: (Observed)16-20kD,25-30kD,40-45kD.
Predicted Mol.Wt.: (Calculated)27kDa.

Subcellular Location:

Secreted. VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin.

Tissue Specificity:

P15692 VEGFA_HUMAN:
Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. A higher level expression seen in pituitary tumors as compared to the pituitary gland.

Description:

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin

Sequence:
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Research Background

Function:

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity).

Subcellular Location:

Secreted.
Note: VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a significant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. A higher level expression seen in pituitary tumors as compared to the pituitary gland.

Subunit Structure:

Homodimer; disulfide-linked. Also found as heterodimer with PGF (By similarity). Interacts with NRP1 (PubMed:26503042).

Similarity:

Belongs to the PDGF/VEGF growth factor family.

Research Fields

Research Fields:

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.(View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.(View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.(View pathway)
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.(View pathway)
· Human Diseases > Cancers: Specific types > Pancreatic cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Renal cell carcinoma.(View pathway)
· Human Diseases > Cancers: Specific types > Bladder cancer.(View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer.(View pathway)
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Human Diseases > Cancers: Overview > MicroRNAs in cancer.
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.
· Organismal Systems > Endocrine system > Relaxin signaling pathway.

Reference Citations:

1). Ai XY et al. Phenytoin silver: a new nanocompound for promoting dermal wound healing via comprehensive pharmacological action. Theranostics 2017 Jan 5;7(2):425-435 (PubMed: 28255340) [IF=8.063]

Application: WB    Species:human;    Sample:Not available

Figure 6. PnAg regulates gp130/Jak/Stat3 signaling pathway (A) and (B) NIH-3T3 and HaCat Cells were treated with PnAg at different concentrations and cell viability was tested using MTT analysis. (C) Wound healing assay reflected the effect of PnAg on cell migration. (D) Binding mode of PnAg in the active pocket of gp130. (E) and (F) MMPs activity and expression levels of Stat3, VEGF, TGFB-1, and TGFB1 detected using zymographic and Western blot assays. (G) Diagram of the proposed function of PnAg in wound inflammation and re-epithelialization controls.


2). Yang W et al. Co-overexpression of VEGF and GDNF in adipose-derived stem cells optimizes therapeutic effect in neurogenic erectile dysfunction model. Cell Prolif 2020 Jan 13:e12756 (PubMed: 31943490) [IF=5.039]

3). Chen X et al. SMURF1-mediated ubiquitination of ARHGAP26 promotes ovarian cancer cell invasion and migration. Exp Mol Med 2019 Apr 19;51(4):46 (PubMed: 31004081) [IF=4.743]

4). An Y et al. Exosomes from Adipose-Derived Stem Cells (ADSCs) Overexpressing miR-21 Promote Vascularization of Endothelial Cells. Sci Rep 2019 Sep 6;9(1):12861 (PubMed: 31492946) [IF=4.011]

5). He WH et al. Estradiol promotes trophoblast viability and invasion by activating SGK1. Biomed Pharmacother 2019 Sep;117:109092 (PubMed: 31203134) [IF=3.743]

6). Xu D et al. The synergistic action of phosphate and interleukin-6 enhances senescence-associated calcification in vascular smooth muscle cells depending on p53. Mech Ageing Dev 2019 Jul 31:111124 (PubMed: 31376399) [IF=3.603]

7). Deng S et al. The regulatory roles of VEGF-Notch signaling pathway on aplastic anemia with kidney deficiency and blood stasis. J Cell Biochem 2018 Sep 19 (PubMed: 30230583) [IF=3.448]

8). Tu Q et al. Effects of adiponectin on random pattern skin flap survival in rats. Int Immunopharmacol 2019 Sep 5;76:105875 (PubMed: 31499269) [IF=3.361]

9). Feng X et al. Protective effect of citicoline on random flap survival in a rat mode. Int Immunopharmacol 2020 Apr 1;83:106448 (PubMed: 32247268) [IF=3.361]

10). Huang G et al. Protective effects of icariin on dorsal random skin flap survival: An experimental study. Eur J Pharmacol 2019 Aug 8:172600 (PubMed: 31401155) [IF=3.170]

11). Wu CZ et al. HMGB1/RAGE axis mediates the apoptosis, invasion, autophagy, and angiogenesis of the renal cell carcinoma. Onco Targets Ther 2018 Aug 1;11:4501-4510 (PubMed: 30122942) [IF=3.046]

12). Chen W et al. Electroacupuncture facilitates implantation by enhancing endometrial angiogenesis in a rat model of ovarian hyperstimulation. Biol Reprod 2018 Aug 1 (PubMed: 30084973)

13). Shang H et al. Nevirapine inhibits migration and invasion in dedifferentiated thyroid cancer cells. Thorac Cancer 2019 Oct 21 (PubMed: 31631580)

14). Sun X et al. Changes in neurological and pathological outcomes in a modified rat spinal cord injury model with closed canal. Neural Regen Res 2020 Apr;15(4):697-704 (PubMed: 31638094)

15). An S et al. Administration of CoCl2 Improves Functional Recovery in a Rat Model of Sciatic Nerve Transection Injury. Int J Med Sci 2018 Sep 7;15(13):1423-1432 (PubMed: 30443161)

16). An S et al. Administration of CoCl2 Improves Functional Recovery in a Rat Model of Sciatic Nerve Transection Injury. Int J Med Sci 2018 Sep 7;15(13):1423-1432 (PubMed: 30443161)

17). Shang J et al. CircPAN3 contributes to drug resistance in acute myeloid leukemia through regulation of autophagy. Leuk Res 2019 Aug 2;85:106198 (PubMed: 31401408)

18). Li Q et al. CoCl2 increases the expression of hypoxic markers HIF-1α, VEGF and CXCR4 in breast cancer MCF-7 cells. Oncol Lett 2018 Jan;15(1):1119-1124 (PubMed: 29391899)

19). Yin LL et al. Lenalidomide improvement of cisplatin antitumor efficacy on triple-negative breast cancer cells in vitro. Oncol Lett 2018 May;15(5):6469-6474 (PubMed: 29616116)

20). Li J et al. HIF1A and VEGF regulate each other by competing endogenous RNA mechanism and involve in the pathogenesis of peritoneal fibrosis. Pathol Res Pract 2018 Dec 26 (PubMed: 30598338)

21). Feng X et al. Effects of Asiaticoside Treatment on the Survival of Random Skin Flaps in Rats. J Invest Surg 2019 Mar 21:1-11 (PubMed: 30898065)

22). Liu L et al. Berberine inhibits the LPS-induced proliferation and inflammatory response of stromal cells of adenomyosis tissues mediated by the LPS/TLR4 signaling pathway. Exp Ther Med 2017 Dec;14(6):6125-6130 (PubMed: 29285168)

23). Yang L et al. Angiogenic function of astragaloside IV in rats with myocardial infarction occurs via the PKD1-HDAC5-VEGF pathway. Exp Ther Med 2019 Apr;17(4):2511-2518 (PubMed: 30906439)

24). Gong Q et al. Upregulated VEGF and Robo4 correlate with the reduction of miR-15a in the development of diabetic retinopathy. Endocrine 2019 Apr 12 (PubMed: 30980286)

25). Gao HQ et al. Tirofiban Promotes the Proliferation of Human Umbilical Vein Endothelial Cells In Vitro Via Enhanced Vascular Endothelial Growth Factor Expression. Transplant Proc 2020 Jan - Feb;52(1):419-422 (PubMed: 31948801)

26). Xin XL et al. Mechanisms of IFNalpha-1a-Induced Apoptosis in a Laryngeal Cancer Cell Line. Med Sci Monit 2019 Sep 22;25:7100-7114 (PubMed: 31542790)

27). et al. Co-Overexpressing VEGF and GDNF of ADSCs Ameliorate Erectile Dysfunction by Alleviating Cavernosal Fibrosis in a Rat Model of Bilateral Cavernous Nerve Injury.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF5131-BP
(Blocking peptide available as AF5131-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Rabbit
100%
Pig
100%
Dog
100%
Sheep
90%
Horse
89%
Bovine
89%
Chicken
0%
Xenopus
0%
Zebrafish
0%
High similarity Medium similarity Low similarity No similarity
P15692 as Substrate
Site PTM Type Enzyme
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top