NCOA4 Antibody | Affinity Biosciences

Product:	NCOA4 Antibody
Catalog:	DF4255
Description:	Rabbit polyclonal antibody to NCOA4
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat
Mol.Wt.:	70~90KD; 70kD(Calculated).
Uniprot:	Q13772
RRID:	AB_2836606

View similar products>>

Related products

Secondary Antibodies
Blocking Peptides

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:1000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

NCOA4 Antibody detects endogenous levels of total NCOA4.

RRID:

AB_2836606
Cite Format: Affinity Biosciences Cat# DF4255, RRID:AB_2836606.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

70 kDa androgen receptor activator; 70 kDa androgen receptor coactivator; 70 kDa AR activator; 70 kDa AR-activator; Androgen receptor coactivator 70 kD; Androgen receptor coactivator 70 kDa protein; Androgen receptor-associated protein of 70 kDa; ARA 70; ARA70; DKFZp762E1112; ELE 1; ELE1; ELE1/ret TK; NCOA 4; NCoA-4; NCOA4; NCOA4_HUMAN; Nuclear receptor coactivator 4; Papillary thyroid carcinoma 3; PTC 3; PTC3; RET activating gene ELE1; Ret activating protein ELE1; Ret-activating protein ELE1; RFG;

Immunogens

Immunogen:

Uniprot:

Q13772(NCOA4_HUMAN) >>Visit HPA database.

Gene(ID):

NCOA4(8031)

Expression:

Q13772 NCOA4_HUMAN:

Widely expressed. Also detected in adipose tissues and in different cell lines. Isoform Beta is only expressed in testis.

Sequence:

Q13772 NCOA4_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDENCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIKNSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM

PTMs - Q13772 As Substrate

Q13772

Site	PTM Type	Source
K42	Ubiquitination	Uniprot
K49	Ubiquitination	Uniprot
S57	Phosphorylation	Uniprot
S156	Phosphorylation	Uniprot
S171	Phosphorylation	Uniprot
S172	Phosphorylation	Uniprot
K181	Ubiquitination	Uniprot
S186	Phosphorylation	Uniprot
S194	Phosphorylation	Uniprot
K209	Ubiquitination	Uniprot
S212	Phosphorylation	Uniprot
K231	Ubiquitination	Uniprot
S237	Phosphorylation	Uniprot
S240	Phosphorylation	Uniprot
S241	Phosphorylation	Uniprot
K255	Ubiquitination	Uniprot
K263	Ubiquitination	Uniprot
K266	Ubiquitination	Uniprot
K271	Ubiquitination	Uniprot
T307	Phosphorylation	Uniprot
K313	Ubiquitination	Uniprot
K316	Ubiquitination	Uniprot
S334	Phosphorylation	Uniprot
K356	Ubiquitination	Uniprot
K367	Ubiquitination	Uniprot
K377	Ubiquitination	Uniprot
S412	Phosphorylation	Uniprot
K424	Ubiquitination	Uniprot
K429	Ubiquitination	Uniprot
K439	Ubiquitination	Uniprot
K447	Ubiquitination	Uniprot
K454	Ubiquitination	Uniprot
S456	Phosphorylation	Uniprot
K465	Ubiquitination	Uniprot
K472	Ubiquitination	Uniprot
K475	Ubiquitination	Uniprot
K490	Ubiquitination	Uniprot
S492	Phosphorylation	Uniprot
K504	Ubiquitination	Uniprot
S507	Phosphorylation	Uniprot
K509	Ubiquitination	Uniprot
K544	Ubiquitination	Uniprot
K545	Ubiquitination	Uniprot
S553	Phosphorylation	Uniprot
S554	Phosphorylation	Uniprot
K558	Ubiquitination	Uniprot

Research Backgrounds

Q13772_NCOA4_HUMAN

Function:

Enhances the androgen receptor transcriptional activity in prostate cancer cells. Ligand-independent coactivator of the peroxisome proliferator-activated receptor (PPAR) gamma.

Tissue Specificity:

Widely expressed. Also detected in adipose tissues and in different cell lines. Isoform Beta is only expressed in testis.

Subunit Structure:

Interacts with the androgen receptor and the retinoid X receptor (RXR) in a ligand-dependent manner.

Research Fields

· Cellular Processes > Cell growth and death > Ferroptosis. (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)

· Human Diseases > Cancers: Specific types > Thyroid cancer. (View pathway)

References

1). Arsenic induces pancreatic dysfunction and ferroptosis via mitochondrial ROS-autophagy-lysosomal pathway. JOURNAL OF HAZARDOUS MATERIALS (PubMed: 31735470) [IF=13.6]

Application: WB Species: Rat Sample: MIN6 cells

Fig. 6 Ferroptosis was triggered by MtROS-dependent autophagy. (A) Effects of NaAsO2 (4  and TEMPO on LC3 and p62 in MIN6 cells. (B) Autophagic flux analysis. (C) The efficiency of CQ, and its effect on GPX4 and COX-2 in NaAsO2- Journal Pre-proof treated MIN6 cells. (D) Effects of NaAsO2 and CQ on relative GSH, T-SOD, and MDA content in MIN6 cells. (E) Effects of CQ on the NaAsO2-induced accumulation of lipid ROS by BODIPY 581/591 C11 staining (scale bar = 50 m). (F) Effects of CQ on the NaAsO2-induced insulin released using an ELISA kit. All results are expressed as the mean ± SD, n = 3. *P < 0.05, **P < 0.001 vs. control group, #P < 0.05, ##P < 0.001 vs. NaAsO2 group.

2). Induction of autophagy via the ROS-dependent AMPK-mTOR pathway protects copper-induced spermatogenesis disorder. Redox Biology (PubMed: 34979450) [IF=11.4]

Application: WB Species: Mouse Sample: GC-1 spg cells

Fig. 8 Autophagy triggered ferroptosis in CuSO4-treated GC-1 spg cells. (a) Cells were treated with CuSO4 (0, 0.4, 0.8 and 1.6 mM) for 12h and 24h. The Western blot results of GPX4 and COX-2 protein expression. (b) The quantification of GPX4 and COX-2. (c) Cells were treated with CuSO4 (1.6 mM, 24h) in the presence/absence of 3-MA (1 mM, 1h), the changes of GPX4, COX-2, NCOA4 and FTH1. (d) Cells transfected with control shRNA and ATG5 shRNA exposed with CuSO4 (1.6 mM) for 24 h, changes of GPX4, COX-2, NCOA4 and FTH1. Data are presented with the means ± standard deviation. *p < 0.05 **p < 0.01.

3). d-Borneol enhances cisplatin sensitivity via autophagy dependent EMT signaling and NCOA4-mediated ferritinophagy. PHYTOMEDICINE (PubMed: 36030746) [IF=7.9]

4). Melatonin inhibits ferroptosis and delays age-related cataract by regulating SIRT6/p-Nrf2/GPX4 and SIRT6/NCOA4/FTH1 pathways. Biomedicine & Pharmacotherapy (PubMed: 36463827) [IF=7.5]

5). YAP1 alleviates sepsis-induced acute lung injury via inhibiting ferritinophagy-mediated ferroptosis. Frontiers in Immunology (PubMed: 35979359) [IF=7.3]

Application: WB Species: Mice Sample: MLE-12 cells.

Figure 3 YAP1 restrained the degradation of ferritin in lysosomes to suppress ferritinophagy. (A) Confocal images of ferritin (red) and LAMP2 (green) were shown in LPS-treated MLE-12 cells, while lysosomes were stained with LAMP2 (green). (B) Quantification measurement of lysosome fluorescence intensity. (C) Quantification measurement of ferritin fluorescence intensity. (D–G) Data showed the expression contents of LC3II/LC3I (E), NCOA4 (F), and FTH1 (G). Data are expressed as mean ± SD. n = 3; *p < 0.05, **p < 0.01, ***p < 0.001. NS: no significance, P>0.05.

6). Alleviated NCOA4-mediated ferritinophagy protected RA FLSs from ferroptosis in lipopolysaccharide-induced inflammation under hypoxia. Inflammation research : official journal of the European Histamine Research Society ... [et al.] (PubMed: 38189810) [IF=6.7]

7). Patulin Induces Acute Kidney Injury in Mice through Autophagy–Ferroptosis Pathway. JOURNAL OF AGRICULTURAL AND FOOD CHEMISTRY (PubMed: 35543324) [IF=6.1]

8). Astaxanthin alleviates lipopolysaccharide-induced acute lung injury by suppressing ferroptosis. Food & Function (PubMed: 37326488) [IF=6.1]

9). Chrysin induces autophagy-dependent ferroptosis to increase chemosensitivity to gemcitabine by targeting CBR1 in pancreatic cancer cells. Biochemical Pharmacology (PubMed: 34673014) [IF=5.8]

10). SNS alleviates depression-like behaviors in CUMS mice by regluating dendritic spines via NCOA4-mediated ferritinophagy. Journal of Ethnopharmacology (PubMed: 37028613) [IF=5.4]

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

NCOA4 Antibody - #DF4255