HBP1 Antibody - #AF0338
Product: | HBP1 Antibody |
Catalog: | AF0338 |
Description: | Rabbit polyclonal antibody to HBP1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 57kDa; 58kD(Calculated). |
Uniprot: | O60381 |
RRID: | AB_2833292 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0338, RRID:AB_2833292.
Fold/Unfold
FLJ16340; HBP 1; HBP1; HBP1_HUMAN; High mobility group box transcription factor 1; HMG box containing protein 1; HMG box transcription factor 1; HMG box-containing protein 1;
Immunogens
- O60381 HBP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLPELQAVQSDPTQSGMYQLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDWLTELANIATSPQSPLMQCSFYNRSSPVHIIATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHERANSESESGIFCMSSLSDDDDLGWCNSWPSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDSGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O60381 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K16 | Ubiquitination | Uniprot | |
K23 | Ubiquitination | Uniprot | |
S135 | Phosphorylation | Uniprot | |
S156 | Phosphorylation | Uniprot | |
S157 | Phosphorylation | Uniprot | |
S158 | Phosphorylation | Uniprot | |
S159 | Phosphorylation | Uniprot | |
K171 | Acetylation | Uniprot | |
K225 | Ubiquitination | Uniprot | |
K229 | Ubiquitination | Uniprot | |
K255 | Ubiquitination | Uniprot | |
K263 | Ubiquitination | Uniprot | |
K297 | Acetylation | Uniprot | |
K297 | Ubiquitination | Uniprot | |
K305 | Acetylation | Uniprot | |
K305 | Ubiquitination | Uniprot | |
K307 | Acetylation | Uniprot | |
S372 | Phosphorylation | Uniprot | |
S380 | Phosphorylation | Uniprot | |
S382 | Phosphorylation | Uniprot | |
K398 | Ubiquitination | Uniprot | |
S402 | Phosphorylation | Q15759 (MAPK11) , Q16539 (MAPK14) | Uniprot |
K416 | Ubiquitination | Uniprot | |
K419 | Acetylation | Uniprot | |
K419 | Ubiquitination | Uniprot | |
S430 | Phosphorylation | Uniprot | |
K433 | Ubiquitination | Uniprot | |
T453 | Phosphorylation | Uniprot | |
T484 | Phosphorylation | Uniprot | |
K488 | Ubiquitination | Uniprot | |
K495 | Ubiquitination | Uniprot | |
K503 | Ubiquitination | Uniprot | |
S509 | Phosphorylation | Uniprot |
Research Backgrounds
Transcriptional repressor that binds to the promoter region of target genes. Plays a role in the regulation of the cell cycle and of the Wnt pathway. Binds preferentially to the sequence 5'-TTCATTCATTCA-3'. Binding to the histone H1.0 promoter is enhanced by interaction with RB1. Disrupts the interaction between DNA and TCF4.
Ubiquitinated by the CTLH E3 ubiquitin-protein ligase complex, leading to subsequent proteasomal degradation.
Nucleus.
Binds the second PAH repeat of SIN3A (Probable). Binds TCF4. Binds RB1.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.