Product: Phospho-HBP1 (Ser402) Antibody
Catalog: AF0031
Source: Rabbit
Application: WB, IF/ICC, ELISA(peptide)
Reactivity: Human
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 58kD; 58kD(Calculated).
Uniprot: O60381
RRID: AB_2833291

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human
Prediction:
Pig(88%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
Phospho-HBP1 (Ser402) Antibody detects endogenous levels of HBP1 only when phosphorylated at Sersine 402.
RRID:
AB_2833291
Cite Format: Affinity Biosciences Cat# AF0031, RRID:AB_2833291.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

FLJ16340; HBP 1; HBP1; HBP1_HUMAN; High mobility group box transcription factor 1; HMG box containing protein 1; HMG box transcription factor 1; HMG box-containing protein 1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
HBP1 trembl
Sequence:
MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLPELQAVQSDPTQSGMYQLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDWLTELANIATSPQSPLMQCSFYNRSSPVHIIATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHERANSESESGIFCMSSLSDDDDLGWCNSWPSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDSGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Pig
88
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - O60381 As Substrate

Site PTM Type Enzyme
K16 Ubiquitination
K23 Ubiquitination
S135 Phosphorylation
S156 Phosphorylation
S157 Phosphorylation
S158 Phosphorylation
S159 Phosphorylation
K171 Acetylation
K225 Ubiquitination
K229 Ubiquitination
K255 Ubiquitination
K263 Ubiquitination
K297 Acetylation
K297 Ubiquitination
K305 Acetylation
K305 Ubiquitination
K307 Acetylation
S372 Phosphorylation
S380 Phosphorylation
S382 Phosphorylation
K398 Ubiquitination
S402 Phosphorylation Q15759 (MAPK11) , Q16539 (MAPK14)
K416 Ubiquitination
K419 Acetylation
K419 Ubiquitination
S430 Phosphorylation
K433 Ubiquitination
T453 Phosphorylation
T484 Phosphorylation
K488 Ubiquitination
K495 Ubiquitination
K503 Ubiquitination
S509 Phosphorylation

Research Backgrounds

Function:

Transcriptional repressor that binds to the promoter region of target genes. Plays a role in the regulation of the cell cycle and of the Wnt pathway. Binds preferentially to the sequence 5'-TTCATTCATTCA-3'. Binding to the histone H1.0 promoter is enhanced by interaction with RB1. Disrupts the interaction between DNA and TCF4.

PTMs:

Ubiquitinated by the CTLH E3 ubiquitin-protein ligase complex, leading to subsequent proteasomal degradation.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Binds the second PAH repeat of SIN3A (Probable). Binds TCF4. Binds RB1.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.