Price Size
$280 100ul
$350 200ul

Same day delivery

Contact distributor
  • Product Name
    Phospho-HBP1 (Ser402) Antibody
  • Catalog No.
    AF0031
  • RRID
    AB_2833291
  • Source
    Rabbit
  • Application
    WB,IF/ICC,ELISA
  • Reactivity
    Human
  • Prediction
    Pig(88%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
  • UniProt
  • Mol.Wt
    58kD;
    58kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

FLJ16340; HBP 1; HBP1; HBP1_HUMAN; High mobility group box transcription factor 1; HMG box containing protein 1; HMG box transcription factor 1; HMG box-containing protein 1;

Applications:

WB 1:500-1:2000, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human

Predicted Reactivity:

Pig(88%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Specificity:

Phospho-HBP1 (Ser402) Antibody detects endogenous levels of HBP1 only when phosphorylated at Sersine 402.

RRID:

AB_2833291
Please cite this product as: Affinity Biosciences Cat# AF0031, RRID:AB_2833291.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

A synthesized peptide derived from human HBP1 around the phosphorylation site of Ser402.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

HBP1

Molecular Weight:

Observed Mol.Wt.: 58kD.
Predicted Mol.Wt.: 58kDa(Calculated)..

Subcellular Location:

Nucleus.

Description:

HBP1 trembl

Sequence:
MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLPELQAVQSDPTQSGMYQLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDWLTELANIATSPQSPLMQCSFYNRSSPVHIIATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHERANSESESGIFCMSSLSDDDDLGWCNSWPSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDSGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH

Research Background

Function:

Transcriptional repressor that binds to the promoter region of target genes. Plays a role in the regulation of the cell cycle and of the Wnt pathway. Binds preferentially to the sequence 5'-TTCATTCATTCA-3'. Binding to the histone H1.0 promoter is enhanced by interaction with RB1. Disrupts the interaction between DNA and TCF4.

Post-translational Modifications:

Ubiquitinated by the CTLH E3 ubiquitin-protein ligase complex, leading to subsequent proteasomal degradation.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Subunit Structure:

Binds the second PAH repeat of SIN3A (Probable). Binds TCF4 (PubMed:11500377). Binds RB1 (PubMed:10958660).

WB Images(1)


IF/ICC Images(1)


ELISA analysis of AF0031 showing specificity to Phospho-HBP1 (Ser402) Blocking Peptide peptide. Peptides concentration: 1ug/ml.
P-peptide: phospho-peptide; N-peptide: non-phospho-peptide.
No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF0031-BP
(Blocking peptide available as AF0031-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Rabbit
100%
Sheep
100%
Dog
100%
Horse
100%
Bovine
100%
Pig
88%
Chicken
0%
Xenopus
0%
Zebrafish
0%
High similarity Medium similarity Low similarity No similarity
O60381 as Substrate
Site PTM Type Enzyme
K16 Ubiquitination
K23 Ubiquitination
S135 Phosphorylation
S156 Phosphorylation
S157 Phosphorylation
S158 Phosphorylation
S159 Phosphorylation
K171 Acetylation
K225 Ubiquitination
K229 Ubiquitination
K255 Ubiquitination
K263 Ubiquitination
K297 Acetylation
K297 Ubiquitination
K305 Acetylation
K305 Ubiquitination
K307 Acetylation
S372 Phosphorylation
S380 Phosphorylation
S382 Phosphorylation
K398 Ubiquitination
S402 Phosphorylation Q15759 (MAPK11) , Q16539 (MAPK14)
K416 Ubiquitination
K419 Acetylation
K419 Ubiquitination
S430 Phosphorylation
K433 Ubiquitination
T453 Phosphorylation
T484 Phosphorylation
K488 Ubiquitination
K495 Ubiquitination
K503 Ubiquitination
S509 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top