MBD3 Antibody - #AF0353
Product: | MBD3 Antibody |
Catalog: | AF0353 |
Description: | Rabbit polyclonal antibody to MBD3 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken |
Mol.Wt.: | 33kDa; 33kD(Calculated). |
Uniprot: | O95983 |
RRID: | AB_2833519 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0353, RRID:AB_2833519.
Fold/Unfold
AI181826; AU019209; MBD 3; Mbd3; MBD3: methyl CpG binding domain protein 3; MBD3_HUMAN; Methyl CpG binding domain protein 3; Methyl CpG binding protein MBD3; Methyl-CpG-binding domain protein 3; Methyl-CpG-binding protein MBD3;
Immunogens
A synthesized peptide derived from human MBD3, corresponding to a region within C-terminal amino acids.
- O95983 MBD3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95983 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S24 | Phosphorylation | O14965 (AURKA) | Uniprot |
Y35 | Phosphorylation | Uniprot | |
Y36 | Phosphorylation | Uniprot | |
S37 | Phosphorylation | Uniprot | |
S39 | Phosphorylation | Uniprot | |
S45 | Phosphorylation | Uniprot | |
S56 | Phosphorylation | Uniprot | |
T61 | Phosphorylation | Uniprot | |
T66 | Phosphorylation | Uniprot | |
S77 | Phosphorylation | Uniprot | |
Y83 | Phosphorylation | Uniprot | |
S85 | Phosphorylation | O14965 (AURKA) | Uniprot |
S86 | Phosphorylation | Uniprot | |
K92 | Ubiquitination | Uniprot | |
T97 | Phosphorylation | Uniprot | |
K109 | Acetylation | Uniprot | |
K109 | Sumoylation | Uniprot | |
K129 | Ubiquitination | Uniprot | |
K141 | Acetylation | Uniprot | |
K141 | Ubiquitination | Uniprot | |
K142 | Ubiquitination | Uniprot | |
S144 | Phosphorylation | Uniprot | |
K157 | Ubiquitination | Uniprot | |
T221 | Phosphorylation | Uniprot | |
K227 | Ubiquitination | Uniprot |
Research Backgrounds
Acts as transcriptional repressor and plays a role in gene silencing. Does not bind to DNA by itself. Binds to DNA with a preference for sites containing methylated CpG dinucleotides (in vitro). Binds to a lesser degree DNA containing unmethylated CpG dinucleotides. Recruits histone deacetylases and DNA methyltransferases.
Nucleus. Chromosome.
Note: Nuclear, in discrete foci. Detected on chromatin, at promoter regions of active genes.
Heterodimer with MBD2. Part of the NuRD and the MeCP1 complex. Interacts with BCL6, HDAC1, MTA2, DNMT1, p66-alpha and p66-beta.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.