PFKFB2 Antibody - #AF0344
Product: | PFKFB2 Antibody |
Catalog: | AF0344 |
Description: | Rabbit polyclonal antibody to PFKFB2 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 58kDa; 58kD(Calculated). |
Uniprot: | O60825 |
RRID: | AB_2833514 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0344, RRID:AB_2833514.
Fold/Unfold
6 phosphofructo 2 kinase/ fructose 2,6 bisphosphatase; 6 phosphofructo 2 kinase/fructose 2,6 biphosphatase 3; 6-bisphosphatase; 6-P2ase 3; 6-P2ASE brain/placenta-type isozyme; 6PF 2 K/Fru 2,6 P2ASE brain/placenta type isozyme; 6PF 2-K/Fru 2,6 P2ase 3; 6PF-2-K/Fru-2; F263_HUMAN; fructose 6 phosphate,2 kinase/fructose 2, 6 bisphosphatase; Fructose-2; Inducible 6 phosphofructo 2 kinase/fructose 2,6 bisphosphatase; iPFK 2; iPFK-2; IPFK2; PFK/FBPase 3; PFK2; PFKFB3; Renal carcinoma antigen NY REN 56; Renal carcinoma antigen NY-REN-56; uPFK 2;
Immunogens
- O60825 F262_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O60825 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Acetylation | Uniprot | |
S13 | Phosphorylation | Uniprot | |
S24 | Phosphorylation | Uniprot | |
S32 | Phosphorylation | Uniprot | |
S84 | Phosphorylation | Uniprot | |
K86 | Ubiquitination | Uniprot | |
K103 | Ubiquitination | Uniprot | |
S175 | Phosphorylation | Uniprot | |
K192 | Ubiquitination | Uniprot | |
K211 | Ubiquitination | Uniprot | |
K279 | Ubiquitination | Uniprot | |
K287 | Ubiquitination | Uniprot | |
K298 | Ubiquitination | Uniprot | |
K305 | Ubiquitination | Uniprot | |
Y356 | Phosphorylation | Uniprot | |
Y358 | Phosphorylation | Uniprot | |
Y366 | Phosphorylation | Uniprot | |
T458 | Phosphorylation | Uniprot | |
S466 | Phosphorylation | P23443 (RPS6KB1) , Q13131 (PRKAA1) , P31749 (AKT1) , P17612 (PRKACA) , P51812 (RPS6KA3) , P54646 (PRKAA2) | Uniprot |
T468 | Phosphorylation | Uniprot | |
S471 | Phosphorylation | Uniprot | |
S472 | Phosphorylation | Uniprot | |
T475 | Phosphorylation | Uniprot | |
Y482 | Phosphorylation | Uniprot | |
S483 | Phosphorylation | P31749 (AKT1) | Uniprot |
S486 | Phosphorylation | Uniprot | |
S493 | Phosphorylation | Uniprot |
Research Backgrounds
Synthesis and degradation of fructose 2,6-bisphosphate.
Phosphorylation by AMPK stimulates activity.
Heart.
Homodimer.
In the C-terminal section; belongs to the phosphoglycerate mutase family.
Research Fields
· Environmental Information Processing > Signal transduction > AMPK signaling pathway. (View pathway)
· Metabolism > Carbohydrate metabolism > Fructose and mannose metabolism.
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.