ANP32C Antibody - #AF0326
Product: | ANP32C Antibody |
Catalog: | AF0326 |
Description: | Rabbit polyclonal antibody to ANP32C |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 26kDa; 27kD(Calculated). |
Uniprot: | O43423 |
RRID: | AB_2833489 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0326, RRID:AB_2833489.
Fold/Unfold
Acidic (leucine rich) nuclear phosphoprotein 32 family, member C; Acidic leucine-rich nuclear phosphoprotein 32 family member C; AN32C_HUMAN; ANP32 C; ANP32C; Phosphoprotein 32 related protein 1; Phosphoprotein 32-related protein 1; pp32 related 1; PP32R1; Tumorigenic protein pp32r1;
Immunogens
Expressed in activated stem cells, such as mobilized CD34+ cells and cord blood CD34+ cells, but not in resting bone marrow CD34+ cells. Expressed in a variety of neoplastic cell lines, mainly in prostatic adenocarcinoma cell lines. Not expressed in normal prostatic tissue.
- O43423 AN32C_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDLPKLKLRKLELRVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDLFNCEVTNLNDYGENVFKLLLQLTYLDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQKRK
PTMs - O43423 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T87 | Phosphorylation | Uniprot | |
K97 | Acetylation | Uniprot | |
S100 | Phosphorylation | Uniprot |
Research Backgrounds
Expressed in activated stem cells, such as mobilized CD34+ cells and cord blood CD34+ cells, but not in resting bone marrow CD34+ cells. Expressed in a variety of neoplastic cell lines, mainly in prostatic adenocarcinoma cell lines. Not expressed in normal prostatic tissue.
Belongs to the ANP32 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.