Product: ARL3 Mouse Monoclonal Antibody
Catalog: BF8824
Description: Mouse monoclonal antibody to ARL3
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 20 kDa; 20kD(Calculated).
Uniprot: P36405

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm8824]
Specificity:
ARL3 Mouse Monoclonal Antibody detects endogenous levels of total ARL3.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ADP ribosylation factor like 3; ADP-ribosylation factor-like protein 3; Arf like 3; Arf like protein 3; ARFL3; ARL3; ARL3_HUMAN;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P36405 ARL3_HUMAN:

Expressed in the retina. Strongly expressed in connecting cilium, the myoid region of the inner segments (IS) and in cone photoreceptors (at protein level).

Sequence:
MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK

PTMs - P36405 As Substrate

Site PTM Type Enzyme
S5 Phosphorylation
K11 Ubiquitination
S12 Phosphorylation
T31 Phosphorylation
T32 Phosphorylation
K35 Ubiquitination
S39 Phosphorylation
T46 Phosphorylation
K54 Ubiquitination
S55 Phosphorylation
S58 Phosphorylation
K115 Ubiquitination
S117 Phosphorylation
C118 S-Nitrosylation
K175 Ubiquitination

Research Backgrounds

Function:

Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). Required for normal cytokinesis and cilia signaling. Requires assistance from GTPase-activating proteins (GAPs) like RP2 and PDE6D, in order to cycle between inactive GDP-bound and active GTP-bound forms. Required for targeting proteins to the cilium, including myristoylated NPHP3 and prenylated INPP5E. Targets NPHP3 to the ciliary membrane by releasing myristoylated NPHP3 from UNC119B cargo adapter into the cilium. Required for PKD1:PKD2 complex targeting from the trans-Golgi network to the cilium (By similarity).

Subcellular Location:

Golgi apparatus membrane>Peripheral membrane protein>Cytoplasmic side. Cytoplasm>Cytoskeleton>Spindle. Nucleus. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm. Cell projection>Cilium.
Note: Detected predominantly in the photoreceptor connecting cilium. Present on the mitotic spindle. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the retina. Strongly expressed in connecting cilium, the myoid region of the inner segments (IS) and in cone photoreceptors (at protein level).

Subunit Structure:

Found in a complex with ARL3, RP2 and UNC119 (or UNC119B); RP2 induces hydrolysis of GTP ARL3 in the complex, leading to the release of UNC119 (or UNC119B). Interacts with RP2; interaction is direct and stimulated with the activated GTP-bound form of ARL3. Interacts with SYS1. The GTP-bound form interacts with ARL2BP and PDE6D. Microtubule-associated protein. May interact with GOLGA4. Interacts with GGA1; the interaction recruits PKD1:PKD2 complex to trans-Golgi network and is required for ciliary targeting of PKD1:PKD2 complex (By similarity).

Family&Domains:

Belongs to the small GTPase superfamily. Arf family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.