TNF alpha Antibody - Internal - AF7014

Price Size
$250 50ul
$350 100ul
$450 200ul

Same day delivery

Contact distributor
  • Product Name
    TNF alpha Antibody
  • Catalog No.
    AF7014
  • RRID
    AB_2835319
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig(100%), Bovine(90%), Sheep(90%), Dog(90%)
  • UniProt
  • Mol.Wt
    (Observed)17/30-35kD; (Calculated)26kDa
  • Concentration
    1mg/ml

  • Browse similar products>>

Related Products

 #AF7014-BP TNF alpha Blocking Peptide $350/1mg

Product Information

Alternative Names:Expand▼

APC1; APC1 protein; Cachectin; DIF; Differentiation inducing factor; Macrophage cytotoxic factor; Tnf; TNF superfamily, member 2; TNF, macrophage derived; TNF, monocyte derived; TNF-a; TNF-alpha; TNFA; TNFA_HUMAN; TNFSF2; Tumor necrosis factor alpha; Tumor necrosis factor; Tumor necrosis factor ligand superfamily member 2; Tumor Necrosis Factor, Membrane Form; Tumor necrosis factor, soluble form;

Applications:

WB 1:500, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig(100%), Bovine(90%), Sheep(90%), Dog(90%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

TNF alpha Antibody detects endogenous levels of total TNF alpha.

RRID:

AB_2835319
Please cite this product as: Affinity Biosciences Cat# AF7014, RRID:AB_2835319.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

PBS, pH 7.4,50% glycerol.

Immunogen Information

Immunogen:

A synthesized peptide derived from human TNF alpha, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

TNF

Molecular Weight:

Observed Mol.Wt.: (Observed)17/30-35kD.
Predicted Mol.Wt.: (Calculated)26kDa.

Subcellular Location:

Secreted and Cell membrane.

Description:

This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation.

Sequence:
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Research Background

Function:

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Upregulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208). Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line (PubMed:22517918, PubMed:16829952, PubMed:23396208). Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance (By similarity).

The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Post-translational Modifications:

The soluble form derives from the membrane form by proteolytic processing. The membrane-bound form is further proteolytically processed by SPPL2A or SPPL2B through regulated intramembrane proteolysis producing TNF intracellular domains (ICD1 and ICD2) released in the cytosol and TNF C-domain 1 and C-domain 2 secreted into the extracellular space.

The membrane form, but not the soluble form, is phosphorylated on serine residues. Dephosphorylation of the membrane form occurs by binding to soluble TNFRSF1A/TNFR1.

O-glycosylated; glycans contain galactose, N-acetylgalactosamine and N-acetylneuraminic acid.

Subcellular Location:

Cell membrane>Single-pass type II membrane protein.

Membrane>Single-pass type II membrane protein.

Secreted.

Secreted.

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Subunit Structure:

Homotrimer. Interacts with SPPL2B.

Similarity:

Belongs to the tumor necrosis factor family.

Research Fields

Research Fields:

· Cellular Processes > Cell growth and death > Apoptosis.(View pathway)
· Cellular Processes > Cell growth and death > Necroptosis.(View pathway)
· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > TNF signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > mTOR signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.(View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.(View pathway)
· Human Diseases > Immune diseases > Graft-versus-host disease.
· Human Diseases > Immune diseases > Systemic lupus erythematosus.
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Human Diseases > Immune diseases > Allograft rejection.
· Human Diseases > Endocrine and metabolic diseases > Type II diabetes mellitus.
· Human Diseases > Cardiovascular diseases > Dilated cardiomyopathy (DCM).
· Human Diseases > Endocrine and metabolic diseases > Type I diabetes mellitus.
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Human Diseases > Cardiovascular diseases > Hypertrophic cardiomyopathy (HCM).
· Human Diseases > Infectious diseases: Bacterial > Legionellosis.
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).
· Human Diseases > Endocrine and metabolic diseases > Insulin resistance.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).
· Human Diseases > Infectious diseases: Parasitic > Malaria.
· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Drug resistance: Antineoplastic > Antifolate resistance.
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Human Diseases > Immune diseases > Asthma.
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
· Organismal Systems > Immune system > RIG-I-like receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > Antigen processing and presentation.(View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage.(View pathway)
· Organismal Systems > Immune system > Toll-like receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > IL-17 signaling pathway.(View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > Fc epsilon RI signaling pathway.(View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.(View pathway)
· Organismal Systems > Endocrine system > Adipocytokine signaling pathway.
· Organismal Systems > Development > Osteoclast differentiation.(View pathway)
· Organismal Systems > Immune system > NOD-like receptor signaling pathway.(View pathway)

Protocols & Troubleshooting

Reference Citations:

1). Zhang D et al. Elastic, Persistently Moisture-Retentive and Wearable Biomimetic Film Inspired by Fetal Scarless Repair for Promoting Skin Wound Healing. ACS Appl Mater Interfaces 2020 Jan 15 (PubMed: 31939277) [IF=8.456]
2). Zheng ZW et al. Development of an Accurate and Proactive Immunomodulatory Strategy to Improve Bone Substitute Material-Mediated Osteogenesis and Angiogenesis. Theranostics 2018 Oct 29;8(19):5482-5500 (PubMed: 30555559) [IF=8.063]
3). Liu W et al. Micheliolide Ameliorates Diabetic Kidney Disease by Inhibiting Mtdh-mediated Renal Inflammation in Type 2 Diabetic db/db Mice. Pharmacol Res 2019 Oct 24:104506 (PubMed: 31669149) [IF=5.574]
4). She P et al. Dextran sulfate-triamcinolone acetonide conjugate nanoparticles for targeted treatment of osteoarthritis. Int J Biol Macromol 2020 May 7 (PubMed: 32389649) [IF=4.784]
5). Zhang DD et al. A novel IL-1RA-PEP fusion protein with enhanced brain penetration ameliorates cerebral ischemia-reperfusion injury by inhibition of oxidative stress and neuroinflammation. Exp Neurol 2017 Nov;297:1-13 (PubMed: 28602833) [IF=4.562]

Application: IHC    Species:mouse;    Sample:Not available

The expression levels of IL-6 and TNF-α in the cerebral tissues of vehicle group were increased significantly in comparison with that of the control group.

6). Wu M et al. Resveratrol delays polycystic kidney disease progression through attenuation of nuclear factor κB-induced inflammation. Nephrol Dial Transplant 2016 Nov;31(11):1826-1834 (PubMed: 27190325) [IF=4.198]

Application: WB    Species:rat;    Sample:Not available

FIGURE 3: Pro-inflammatory factors, anti-oxidant enzyme and cell signaling pathways in resveratrol (Res)- or vehicle-treated cystic kidneys. (A) TNF-α, MCP-1, CFB and SOD2 were analyzed by western blot in 9-week-old +/+ and Cy/+ kidneys. (B–E) Immunohistochemical staining for oxidative stress markers 8-OHdG and nitrotyrosine in the tubulointerstitial area. Computer-assisted morphometry was used to quantify changes of 8-OHdG and nitrotyrosine in each group. Scale bar = 50 µm. (F) NF-κB pathway ( p-p65, p65, p105 and p50) and mTOR pathway ( p-S6K and total S6K) were analyzed by western blot in 9-week-old +/+ and Cy/+ kidneys. Blots are representative of three independent experiments.

7). Hu J et al. Effects of Xin-Ji-Er-Kang on heart failure induced by myocardial infarction: Role of inflammation, oxidative stress and endothelial dysfunction. Phytomedicine 2018 Mar 15;42:245-257 (PubMed: 29655692) [IF=4.180]
8). Hu J et al. Effects of Xin-Ji-Er-Kang on heart failure induced by myocardial infarction: Role of inflammation, oxidative stress and endothelial dysfunction. Phytomedicine 2018 Mar 15;42:245-257 (PubMed: 29655692) [IF=4.180]
9). Sheng X et al. Knockdown the P2X3 receptor in the stellate ganglia of rats relieved the diabetic cardiac autonomic neuropathy. Neurochem Int 2018 Nov;120:206-212 (PubMed: 30196147) [IF=3.994]
10). Zeng SS et al. Treatment With Liraglutide Exerts Neuroprotection After Hypoxic-Ischemic Brain Injury in Neonatal Rats via the PI3K/AKT/GSK3β Pathway. Front Cell Neurosci 2020 Jan 30;13:585 (PubMed: 32082121) [IF=3.900]
11). Feng Y et al. Neuroprotective Effects of Resatorvid Against Traumatic Brain Injury in Rat: Involvement of Neuronal Autophagy and TLR4 Signaling Pathway. Cell Mol Neurobiol 2017 Jan;37(1):155-168 (PubMed: 26961544) [IF=3.811]

Application: WB    Species:rat;    Sample:rat hippocampus

Fig. 7 a Western blot analysis demonstrates levels of TNF-a and IL-1b in the hippocampus of rats at 12, 24, and 48 h following TBI or sham operation (n = 5/group). b Densitometry of the TNF-a and IL-1b band correlated to the b-actin band. The bars represent the mean ± SE (n = 5/group). The results demonstrated that a significant increase of TNF-a and IL-1b expression in the TBI group (*p\0.01 vs. sham group), and treatment with TAK-242 significantly downregulated the level of TNF-a and IL-1b protein expression at 12, 24, and 48 h following TBI (# p\0.05 vs. TBI group). TNF-a, tumor necrosis factor-a; IL-1b, interleukin-1b

12). Zeng SY et al. Nox1/4 dual inhibitor GKT137831 attenuates hypertensive cardiac remodelling associating with the inhibition of ADAM17-dependent proinflammatory cytokines-induced signalling pathways in the rats with abdominal artery constriction. Biomed Pharmacother 2019 Jan;109:1907-1914 (PubMed: 30551445) [IF=3.743]
13). Lu W et al. ApoE deficiency promotes non-alcoholic fatty liver disease in mice via impeding AMPK/mTOR mediated autophagy. Life Sci 2020 Apr 15;252:117601 (PubMed: 32304762) [IF=3.448]
14). Sun L et al. Effects of high-intensity interval training on adipose tissue lipolysis, inflammation, and metabolomics in aged rats. Pflugers Arch 2020 Feb;472(2):245-258 (PubMed: 32006095) [IF=3.377]
15). Feng X et al. Protective effect of citicoline on random flap survival in a rat mode. Int Immunopharmacol 2020 Apr 1;83:106448 (PubMed: 32247268) [IF=3.361]
16). Chen X et al. Nirogacestat suppresses RANKL-Induced osteoclast formation in vitro and attenuates LPS-Induced bone resorption in vivo. Exp Cell Res 2019 Jun 15 (PubMed: 31211955) [IF=3.329]
17). Yuan H et al. Osthole alleviated diabetic neuropathic pain mediated by the P2X4 receptor in dorsal root ganglia. Brain Res Bull 2018 Aug 14;142:289-296 (PubMed: 30118750) [IF=3.103]
18). Guo J et al. Involvement of P2Y12 receptor of stellate ganglion in diabetic cardiovascular autonomic neuropathy. Purinergic Signal 2018 Aug 6 (PubMed: 30084083) [IF=3.038]
19). Zhu L et al. miR-199b-5p Regulates Immune-Mediated Allograft Rejection after Lung Transplantation Through the GSK3β and NF-κB Pathways. Inflammation 2018 Aug;41(4):1524-1535 (PubMed: 29779167)
20). Feng Y et al. Chronic colitis induces meninges traffic of gut-derived T cells, unbalances M1 and M2 microglia/macrophage and increases ischemic brain injury in mice. Brain Res 2018 Nov 13 (PubMed: 30445026)
21). Feng Y et al. Resveratrol attenuates neuronal autophagy and inflammatory injury by inhibiting the TLR4/NF-κB signaling pathway in experimental traumatic brain injury. Int J Mol Med 2016 Apr;37(4):921-30 (PubMed: 26936125)

Application: WB    Species:rat;    Sample:Not available

22). Feng Y et al. Protective Role of Apocynin via Suppression of Neuronal Autophagy and TLR4/NF-κB Signaling Pathway in a Rat Model of Traumatic Brain Injury. Neurochem Res 2017 Nov;42(11):3296-3309 (PubMed: 28786047)

Application: WB    Species:rat;    Sample:Not available

23). Tang S et al. Influences of the TLR4/NF-κB pathway on memory function and inflammatory factors in rats with cerebral small vessel disease. Eur Rev Med Pharmacol Sci 2019 Jul;23(14):6264-6271 (PubMed: 31364129)
24). Li D et al. LPS-induced inflammation delays the transportation of ASP+ due to down-regulation of OCTN1/2 in alveolar epithelial cells. J Drug Target 2019 Oct 8:1-31 (PubMed: 31591905)
25). Chen Y et al. NLRC4 inflammasome activation regulated by TNF-α promotes inflammatory responses in nonalcoholic fatty liver disease. Biochem Biophys Res Commun 2019 Apr 9;511(3):524-530 (PubMed: 30824190)
26). Li S et al. Early supplemental α2-macroglobulin attenuates cartilage and bone damage by inhibiting inflammation in collagen II-induced arthritis model. Int J Rheum Dis 2019 Jan 4 (PubMed: 30609267)
27). Wang X et al. Antiprolactinoma Effect of Hordenine by Inhibiting MAPK Signaling Pathway Activation in Rats. Evid Based Complement Alternat Med 2020 Apr 23;2020:3107290 (PubMed: 32382283)
28). Sheng X et al. Effects of Baicalin on Diabetic Cardiac Autonomic Neuropathy Mediated by the P2Y12 Receptor in Rat Stellate Ganglia. Cell Physiol Biochem 2018;46(3):986-998 (PubMed: 29669327)
29). Zeng SY et al. Rutaecarpine prevents hypertensive cardiac hypertrophy involving the inhibition of Nox4-ROS-ADAM17 pathway. J Cell Mol Med 2019 Apr 5 (PubMed: 30953402)
30). et al. Fungal Proteins from Hericium Erinaceus Show Auxiliary Antitumor Effects with 5-Fluoro-2,4(1H,3H)-Pyrimidinedione by Improving the Gut Microbiota in Mice.
31). et al. Osthole relieves diabetics cardiac autonomic neuropathy associated with P2× 3 receptor in rat stellate ganglia.
32). et al. Fungal Proteins from Hericium Erinaceus Show Auxiliary Antitumor Effects with 5-Fluoro-2, 4 (1H, 3H)-Pyrimidinedione by Improving the Gut Microbiota in Mice.
No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF7014-BP
(Blocking peptide available as AF7014-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide（0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Sheep
90%
Dog
90%
Bovine
90%
Horse
78%
Rabbit
0%
Chicken
0%
Xenopus
0%
Zebrafish
0%
High similarity Medium similarity Low similarity No similarity
P01375 as Substrate
Site PTM Type Enzyme
S2 Phosphorylation Q8N165 (PDIK1L)
K19 Myristoylation
K20 Myristoylation
S80 O-Glycosylation
S162 Phosphorylation
S171 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top