TNF alpha Antibody - Internal - AF7014
-
- Product Name
- TNF alpha Antibody
-
- Catalog No.
- AF7014
-
- RRID
- AB_2835319
-
- Source
- Rabbit
-
- Application
- WB,IHC,IF/ICC,ELISA(peptide)
-
- Reactivity
- Human, Mouse, Rat
-
- Prediction
- Pig(100%), Bovine(90%), Sheep(90%), Dog(90%)
-
- UniProt
-
- Mol.Wt
- 17kD(soluble),25-35kD(membrane);
26kDa(Calculated). -
- Concentration
- 1mg/ml
Related Products
Product Information
Alternative Names:Expand▼
APC1; APC1 protein; Cachectin; DIF; Differentiation inducing factor; Macrophage cytotoxic factor; Tnf; TNF superfamily, member 2; TNF, macrophage derived; TNF, monocyte derived; TNF-a; TNF-alpha; TNFA; TNFA_HUMAN; TNFSF2; Tumor necrosis factor alpha; Tumor necrosis factor; Tumor necrosis factor ligand superfamily member 2; Tumor Necrosis Factor, Membrane Form; Tumor necrosis factor, soluble form;
Applications:
WB 1:500, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human, Mouse, Rat
Predicted Reactivity:
Pig(100%), Bovine(90%), Sheep(90%), Dog(90%)
Source:
Rabbit
Clonality:
Polyclonal
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Specificity:
TNF alpha Antibody detects endogenous levels of total TNF alpha.
RRID:
AB_2835319
Please cite this product as: Affinity Biosciences Cat# AF7014, RRID:AB_2835319.
Format:
Liquid
Concentration:
1mg/ml
Storage Condition and Buffer:
PBS, pH 7.4,50% glycerol.
Immunogen Information
Immunogen:
A synthesized peptide derived from human TNF alpha, corresponding to a region within the internal amino acids.
Uniprot:
>>Visit The Human Protein Atlas
Gene ID:
Gene Name:
TNF
Molecular Weight:
Observed Mol.Wt.: 17kD(soluble),25-35kD(membrane).
Predicted Mol.Wt.: 26kDa(Calculated)..
Subcellular Location:
Secreted and Cell membrane.
Description:
This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation.
Sequence:
- P01375 TNFA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Research Background
Function:
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Upregulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective. Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance (By similarity).
The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
Post-translational Modifications:
The soluble form derives from the membrane form by proteolytic processing. The membrane-bound form is further proteolytically processed by SPPL2A or SPPL2B through regulated intramembrane proteolysis producing TNF intracellular domains (ICD1 and ICD2) released in the cytosol and TNF C-domain 1 and C-domain 2 secreted into the extracellular space.
The membrane form, but not the soluble form, is phosphorylated on serine residues. Dephosphorylation of the membrane form occurs by binding to soluble TNFRSF1A/TNFR1.
O-glycosylated; glycans contain galactose, N-acetylgalactosamine and N-acetylneuraminic acid.
Subcellular Location:
Cell membrane>Single-pass type II membrane protein.
Membrane>Single-pass type II membrane protein.
Secreted.
Secreted.
Secreted.
Subunit Structure:
Homotrimer. Interacts with SPPL2B.
Similarity:
Belongs to the tumor necrosis factor family.
Research Fields
Research Fields:
· Cellular Processes > Cell growth and death > Necroptosis.(View pathway)
· Cellular Processes > Cell growth and death > Apoptosis.(View pathway)
· Environmental Information Processing > Signal transduction > TNF signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.(View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.(View pathway)
· Environmental Information Processing > Signal transduction > mTOR signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.(View pathway)
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).
· Human Diseases > Endocrine and metabolic diseases > Insulin resistance.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).
· Human Diseases > Infectious diseases: Parasitic > Malaria.
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Drug resistance: Antineoplastic > Antifolate resistance.
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Human Diseases > Immune diseases > Asthma.
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
· Human Diseases > Cardiovascular diseases > Hypertrophic cardiomyopathy (HCM).
· Human Diseases > Immune diseases > Graft-versus-host disease.
· Human Diseases > Immune diseases > Systemic lupus erythematosus.
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Human Diseases > Immune diseases > Allograft rejection.
· Human Diseases > Endocrine and metabolic diseases > Type II diabetes mellitus.
· Human Diseases > Cardiovascular diseases > Dilated cardiomyopathy (DCM).
· Human Diseases > Endocrine and metabolic diseases > Type I diabetes mellitus.
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Human Diseases > Infectious diseases: Bacterial > Legionellosis.
· Organismal Systems > Immune system > NOD-like receptor signaling pathway.(View pathway)
· Organismal Systems > Development > Osteoclast differentiation.(View pathway)
· Organismal Systems > Endocrine system > Adipocytokine signaling pathway.
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.(View pathway)
· Organismal Systems > Immune system > Fc epsilon RI signaling pathway.(View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > IL-17 signaling pathway.(View pathway)
· Organismal Systems > Immune system > Toll-like receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage.(View pathway)
· Organismal Systems > Immune system > Antigen processing and presentation.(View pathway)
· Organismal Systems > Immune system > RIG-I-like receptor signaling pathway.(View pathway)
Protocols & Troubleshooting
WB Images(2)
IHC Images(5)
IF/ICC Images(1)
Reference Citations:
Application: IHC Species:mouse; Sample:Not available
The expression levels of IL-6 and TNF-α in the cerebral tissues of vehicle group were increased significantly in comparison with that of the control group.
Application: WB Species:rat; Sample:Not available
FIGURE 3: Pro-inflammatory factors, anti-oxidant enzyme and cell signaling pathways in resveratrol (Res)- or vehicle-treated cystic kidneys. (A) TNF-α, MCP-1, CFB and SOD2 were analyzed by western blot in 9-week-old +/+ and Cy/+ kidneys. (B–E) Immunohistochemical staining for oxidative stress markers 8-OHdG and nitrotyrosine in the tubulointerstitial area. Computer-assisted morphometry was used to quantify changes of 8-OHdG and nitrotyrosine in each group. Scale bar = 50 µm. (F) NF-κB pathway ( p-p65, p65, p105 and p50) and mTOR pathway ( p-S6K and total S6K) were analyzed by western blot in 9-week-old +/+ and Cy/+ kidneys. Blots are representative of three independent experiments.
Application: WB Species:rat; Sample:rat hippocampus
Fig. 7 a Western blot analysis demonstrates levels of TNF-a and IL-1b in the hippocampus of rats at 12, 24, and 48 h following TBI or sham operation (n = 5/group). b Densitometry of the TNF-a and IL-1b band correlated to the b-actin band. The bars represent the mean ± SE (n = 5/group). The results demonstrated that a significant increase of TNF-a and IL-1b expression in the TBI group (*p\0.01 vs. sham group), and treatment with TAK-242 significantly downregulated the level of TNF-a and IL-1b protein expression at 12, 24, and 48 h following TBI (# p\0.05 vs. TBI group). TNF-a, tumor necrosis factor-a; IL-1b, interleukin-1b
Application: WB Species:rat; Sample:Not available
Application: WB Species:rat; Sample:Not available
Submit Review
Catalog Number :
AF7014-BP
(Blocking peptide available as AF7014-BP)
Price/Size :
$350/1mg.
Tips: For phospho antibody, we provide phospho peptide（0.5mg) and non-phospho peptide(0.5mg).
Function :
Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.
Format and storage :
Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
Precautions :
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
To Top