Price Size
$250 50ul
$350 100ul
$450 200ul

Same day delivery

Contact distributor
  • Product Name
    Collagen I Antibody
  • Catalog No.
    AF7001
  • RRID
    AB_2835309
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA
  • Reactivity
    Human, Mouse, Rat, Bovine
  • Prediction
    Pig(100%), Zebrafish(89%), Horse(100%), Dog(100%), Chicken(89%)
  • UniProt
  • Mol.Wt
    130-150kD;
    139kDa,129kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

Alpha 1 type I collagen; Alpha 2 type I collagen; alpha 2 type I procollagen; alpha 2(I) procollagen; alpha 2(I)-collagen; Alpha-1 type I collagen; alpha1(I) procollagen; CO1A1_HUMAN; COL1A1; COL1A2; collagen alpha 1 chain type I; Collagen alpha-1(I) chain; collagen alpha-1(I) chain preproprotein; Collagen I alpha 1 polypeptide; Collagen I alpha 2 polypeptide; collagen of skin, tendon and bone, alpha-1 chain; collagen of skin, tendon and bone, alpha-2 chain; Collagen type I alpha 1; Collagen type I alpha 2; EDSC; OI1; OI2; OI3; OI4; pro-alpha-1 collagen type 1; type I proalpha 1; type I procollagen alpha 1 chain; Type I procollagen;

Applications:

WB 1:500-1:1000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000

Reactivity:

Human, Mouse, Rat, Bovine

Predicted Reactivity:

Pig(100%), Zebrafish(89%), Horse(100%), Dog(100%), Chicken(89%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

Collagen I Antibody detects endogenous levels of total Collagen I.

RRID:

AB_2835309
Please cite this product as: Affinity Biosciences Cat# AF7001, RRID:AB_2835309.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

A synthesized peptide derived from human Collagen I, corresponding to a region within N-terminal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

COL1A2,COL1A1

Molecular Weight:

Observed Mol.Wt.: 130-150kD.
Predicted Mol.Wt.: 139kDa,129kDa(Calculated)..

Subcellular Location:

Secreted > extracellular space > extracellular matrix.

Tissue Specificity:

P02452 CO1A1_HUMAN:
Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

P08123 CO1A2_HUMAN:
Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

Description:

This gene encodes one of the chains for type I collagen, the fibrillar collagen found in most connective tissues. Mutations in this gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. Symptoms associated with mutations in this gene, however, tend to be less severe than mutations in the gene for alpha-1 type I collagen since alpha-2 is less abundant.

Sequence:
MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGLPGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPAGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPTGPVGPVGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPIIDVAPLDVGAPDQEFGFDVGPVCFL

MLSFVDTRTLLLLAVTLCLATCQSLQEETVRKGPAGDRGPRGERGPPGPPGRDGEDGPTGPPGPPGPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGAAGAPGPQGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDGARGAPGAVGAPGPAGATGDRGEAGAAGPAGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGAKGPKGENGVVGPTGPVGAAGPAGPNGPPGPAGSRGDGGPPGMTGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGPRGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNIGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

Research Background

Function:

Type I collagen is a member of group I collagen (fibrillar forming collagen).

Post-translational Modifications:

Contains mostly 4-hydroxyproline. Proline residues at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.

Contains 3-hydroxyproline at a few sites. This modification occurs on the first proline residue in the sequence motif Gly-Pro-Hyp, where Hyp is 4-hydroxyproline.

Lysine residues at the third position of the tripeptide repeating unit (G-X-Y) are 5-hydroxylated in some or all of the chains.

O-glycosylated on hydroxylated lysine residues. The O-linked glycan consists of a Glc-Gal disaccharide.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

Subunit Structure:

Trimers of one alpha 2(I) and two alpha 1(I) chains. Interacts with MRC2 (By similarity). Interacts with TRAM2 (PubMed:14749390). Interacts with MFAP4 in a Ca (2+)-dependent manner (By similarity).

Similarity:

The C-terminal propeptide, also known as COLFI domain, have crucial roles in tissue growth and repair by controlling both the intracellular assembly of procollagen molecules and the extracellular assembly of collagen fibrils. It binds a calcium ion which is essential for its function (By similarity).

Belongs to the fibrillar collagen family.

Function:

Type I collagen is a member of group I collagen (fibrillar forming collagen).

Post-translational Modifications:

Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

Subunit Structure:

Trimers of one alpha 2(I) and two alpha 1(I) chains.

Similarity:

The C-terminal propeptide, also known as COLFI domain, have crucial roles in tissue growth and repair by controlling both the intracellular assembly of procollagen molecules and the extracellular assembly of collagen fibrils. It binds a calcium ion which is essential for its function.

Belongs to the fibrillar collagen family.

Research Fields

Research Fields:

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.(View pathway)
· Environmental Information Processing > Signaling molecules and interaction > ECM-receptor interaction.(View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.(View pathway)
· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Organismal Systems > Immune system > Platelet activation.(View pathway)
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
· Organismal Systems > Digestive system > Protein digestion and absorption.

Reference Citations:

1). Ai XY et al. Phenytoin silver: a new nanocompound for promoting dermal wound healing via comprehensive pharmacological action. Theranostics 2017 Jan 5;7(2):425-435 (PubMed: 28255340) [IF=8.579]

Application: WB    Species:human;    Sample:Not available

Figure 6. PnAg regulates gp130/Jak/Stat3 signaling pathway (A) and (B) NIH-3T3 and HaCat Cells were treated with PnAg at different concentrations and cell viability was tested using MTT analysis. (C) Wound healing assay reflected the effect of PnAg on cell migration. (D) Binding mode of PnAg in the active pocket of gp130. (E) and (F) MMPs activity and expression levels of Stat3, VEGF, TGFB-1, and TGFB1 detected using zymographic and Western blot assays. (G) Diagram of the proposed function of PnAg in wound inflammation and re-epithelialization controls.

Application: IHC    Species:human;    Sample:Not available

Figure 2. PnAg promotes wound healing in SD rats. (A) Photographs of rat skin full-thickness excision wounds on different post-excision days. (B) Change in wound areas of SD rats after treatment; (C) and (D) Expression levels of collagen I, NF-κB, TGF-ß, MMP-2, and MMP-9 in tissues on day 7 and 17 detected by immunohistochemistry. (E) Histogram of protein expression levels in these tissues. (F) and (G) Histomorphological changes in wound tissues stained by Masson trichrome and HE on day 17.


2). Chen J et al. On-demand storage and release of antimicrobial peptides using Pandora's box-like nanotubes gated with a bacterial infection-responsive polymer. Theranostics 2020 Jan 1;10(1):109-122 (PubMed: 31903109) [IF=8.579]

3). DiChuan et al. Stereocomplex poly (lactic acid)-based composite nanofiber membranes with highly dispersed hydroxyapatite for potential bone tissue engineering. COMPOS SCI TECHNOL 2020 May 26 [IF=7.094]

4). Yang M et al. Inhibition of class I HDACs attenuates renal interstitial fibrosis in a murine model. Pharmacol Res 2019 Feb 23 (PubMed: 30807866) [IF=5.893]

5). Shu S et al. Endoplasmic reticulum stress is activated in post-ischemic kidneys to promote chronic kidney disease. EBioMedicine 2018 Oct 9 (PubMed: 30314894) [IF=5.736]

6). Li X et al. Synthesis and discovery of a drug candidate for treatment of idiopathic pulmonary fibrosis through inhibition of TGF-β1 pathway. Eur J Med Chem 2018 Aug 3;157:229-247 (PubMed: 30096654) [IF=5.572]

7). Sun R et al. Rat sinus mucosa- and periosteum-derived exosomes accelerate osteogenesis. J Cell Physiol 2019 Dec;234(12):21947-21961 (PubMed: 31074002) [IF=5.546]

8). Ding Q et al. The role of the apoptosis-related protein BCL-B in the regulation of mitophagy in hepatic stellate cells during the regression of liver fibrosis. Exp Mol Med 2019 Jan 11;51(1):6 (PubMed: 30635551) [IF=5.418]

9). Zhang K et al. Contribution of TGF-Beta-Mediated NLRP3-HMGB1 Activation to Tubulointerstitial Fibrosis in Rat With Angiotensin II-Induced Chronic Kidney Disease. Front Cell Dev Biol 2020 Feb 5;8:1 (PubMed: 32117956) [IF=5.201]

10). Yang Y;Lin Q;Zhou C;Li Q;Li Z;Cao Z;Liang J;Li H;Mei J;Zhang Q;Xiang Q;Xue W;Huang Y; et al. A Testis-Derived Hydrogel as an Efficient Feeder-Free Culture Platform to Promote Mouse Spermatogonial Stem Cell Proliferation and Differentiation. Front Cell Dev Biol 2020 May 19;8:250. (PubMed: 32509769) [IF=5.201]

11). Wu M et al. Reduced asymmetric dimethylarginine accumulation through inhibition of the type I protein arginine methyltransferases promotes renal fibrosis in obstructed kidneys. FASEB J 2019 Mar 6:fj201802585RR (PubMed: 30840839) [IF=4.966]

12). Li X;Yu H;Liang L;Bi Z;Wang Y;Gao S;Wang M;Li H;Miao Y;Deng R;Ma L;Luan J;Li S;Liu M;Lin J;Zhou H;Yang C; et al. Myricetin ameliorates bleomycin-induced pulmonary fibrosis in mice by inhibiting TGF-β signaling via targeting HSP90β. Biochem Pharmacol 2020 Jun 11;114097. (PubMed: 32535102) [IF=4.960]

13). Li Y et al. Transforming Growth Factor-β3/Chitosan Sponge (TGF-β3/CS) Facilitates Osteogenic Differentiation of Human Periodontal Ligament Stem Cells. Int J Mol Sci 2019 Oct 9;20(20) (PubMed: 31600954) [IF=4.556]

14). Li R et al. Salidroside Ameliorates Renal Interstitial Fibrosis by Inhibiting the TLR4/NF-κB and MAPK Signaling Pathways. Int J Mol Sci 2019 Mar 4;20(5) (PubMed: 30836660) [IF=4.556]

15). Wang S et al. Roscovitine attenuates renal interstitial fibrosis in diabetic mice through the TGF-β1/p38 MAPK pathway. Biomed Pharmacother 2019 Apr 24;115:108895 (PubMed: 31029000) [IF=4.545]

16). Li AY et al. Protective role of Gentianella acuta on isoprenaline induced myocardial fibrosis in rats via inhibition of NF-κB pathway. Biomed Pharmacother 2018 Dec 13;110:733-741 (PubMed: 30554111) [IF=4.545]

17). Li X et al. Antifibrotic Mechanism of Cinobufagin in Bleomycin-Induced Pulmonary Fibrosis in Mice. Front Pharmacol 2019 Sep 13;10:1021 (PubMed: 31572194) [IF=4.225]

18). Li Y et al. Sulfonated chitosan oligosaccharide alleviates the inhibitory effect of basic fibroblast growth factor on osteogenic differentiation of human periodontal ligament stem cells. J Periodontol 2019 Oct 1 (PubMed: 31573683) [IF=3.742]

19). Feng F et al. Tanshinone IIA attenuates silica-induced pulmonary fibrosis via Nrf2-mediated inhibition of EMT and TGF-β1/Smad signaling. Chem Biol Interact 2020 Mar 1;319:109024 (PubMed: 32097614) [IF=3.723]

20). Gu L et al. Ribes diacanthum Pall (RDP) ameliorates UUO-induced renal fibrosis via both canonical and non-canonical TGF-β signaling pathways in mice. J Ethnopharmacol 2018 Oct 17 (PubMed: 30342194) [IF=3.690]

21). Yang M et al. Inhibition of MARCO ameliorates silica-induced pulmonary fibrosis by regulating epithelial-mesenchymal transition. Toxicol Lett 2018 Oct 31 (PubMed: 30391304) [IF=3.569]

22). Yang M et al. Therapeutic effects of scavenger receptor MARCO ligand on silica-induced pulmonary fibrosis in rats. Toxicol Lett 2019 Apr 24;311:1-10 (PubMed: 31028789) [IF=3.569]

23). Huang J et al. Aligned topography mediated cell elongation reverses pathological phenotype of in vitro cultured keloid fibroblasts. J Biomed Mater Res A 2019 Feb 6 (PubMed: 30724474) [IF=3.525]

24). Guo J et al. Overexpression of Tumor Necrosis Factor-Like Ligand 1 A in Myeloid Cells Aggravates Liver Fibrosis in Mice. J Immunol Res 2019 Feb 14;2019:7657294 (PubMed: 30906791) [IF=3.327]

25). Li S;Li Y;Xu H;Wei Z;Yang Y;Jin F;Zhang M;Wang C;Song W;Huo J;Zhao J;Yang X;Yang F; et al. ACE2 Attenuates Epithelial-Mesenchymal Transition in MLE-12 Cells Induced by Silica. Drug Des Devel Ther 2020 Apr 21;14:1547-1559. (PubMed: 32368013) [IF=3.216]

26). Fu Y et al. Chronic effects of repeated low dose cisplatin treatment in mouse kidneys and renal tubular cells. Am J Physiol Renal Physiol 2019 Sep 18 (PubMed: 31532246) [IF=3.144]

27). Zhao S et al. TGF-β1 promotes Staphylococcus aureus adhesion to and invasion into bovine mammary fibroblasts via the ERK pathway. Microb Pathog 2017 May;106:25-29 (PubMed: 28131949)

Application: WB    Species:bovine;    Sample:Not available

Fig. 3. S. aureus upregulates the protein expression of p-ERK1/2 to regulate Collagen I and a-SMA expression in BMFBs. Analysis of p-ERK1/2 protein expression in BMFBs after stimulation with 5 ng/ml TGF-b1 for 0 h, 6 h, 12 h, 24 h, 36 h, 48 h and 72 h (A). BMFBs were pretreated with PD98059 2 h before the indicated treatments with 5 ng/ ml TGF-b1. b-actin was used as a loading control for each condition (B). The data shown represent one of three independent experiments.


28). Yao S et al. Porous and nonporous silk fibroin (SF) membranes wrapping for Achilles tendon (AT) repair: Which one is a better choice?. J Biomed Mater Res B Appl Biomater 2018 Oct 11 (PubMed: 30308113)

29). Ma J et al. Locostatin Alleviates Liver Fibrosis Induced by Carbon Tetrachloride in Mice. Dig Dis Sci 2019 Sep;64(9):2570-2580 (PubMed: 30874989)

30). Ruan H et al. Anlotinib attenuated bleomycin-induced pulmonary fibrosis via the TGF-β1 signalling pathway. J Pharm Pharmacol 2019 Oct 28 (PubMed: 31659758)

31). Zhang X et al. Qingshen Buyang Formula Attenuates Renal Fibrosis in 5/6 Nephrectomized Rats via Inhibiting EMT and Wnt/β-Catenin Pathway. Evid Based Complement Alternat Med 2019 May 2;2019:5370847 (PubMed: 31186661)

32). Deng J et al. Protective effect of rosiglitazone on chronic renal allograft dysfunction in rats. Transpl Immunol 2019 Jan 22 (PubMed: 30682409)

33). Hong‑Xia Yang et al. The aqueous extract of Gentianella acuta improves isoproterenol‑induced myocardial fibrosis via inhibition of the TGF‑β1/Smads signaling pathway. International Journal of Molecular Medicine 2019 Nov 21;:223-233

34). Li XH et al. Parthenolide attenuated bleomycin-induced pulmonary fibrosis via the NF-κB/Snail signaling pathway. Respir Res 2018 Jun 5;19(1):111 (PubMed: 29871641)

35). Liu N;Fu D;Yang J;Liu P;Song X;Wang X;Li R;Fu Z;Chen J;Gong X;Chen C;Yang L; et al. Asiatic acid attenuates hypertrophic and fibrotic differentiation of articular chondrocytes via AMPK/PI3K/AKT signaling pathway. Arthritis Res Ther 2020 May 12;22(1):112. (PubMed: 32398124)

36). Tang X et al. The Combination of piR-823 and Eukaryotic Initiation Factor 3 B (EIF3B) Activates Hepatic Stellate Cells via Upregulating TGF-β1 in Liver Fibrogenesis. Med Sci Monit 2018 Dec 17;24:9151-9165 (PubMed: 30556540)

37). et al. LOXL 2 Promotes The Epithelial–Mesenchymal Transition And Malignant Progression Of Cervical Cancer.

38). et al. miR-7-5p Promotes Hepatic Stellate Cell Activation by Targeting Fibroblast Growth Factor Receptor 4.

39). et al. α7nAChR Prevents Premature Cervical Ripening by Inducing M2 Macrophage Polarization and Myofibroblast Differentiation.

40). et al. Lipopolysaccharide-induced premature cervical ripening and inflammation in pregnant mice can be alleviated by nicotine.

41). Xiang-Tong Lu1 et al. Effect of IL-13Rα2 on TGF-β expression and collagen synthesizing induced by IL-13 in human lung fibroblasts HFL-1. Int J Clin Exp Pathol 2017;10(6):6845-6853

42). et al. Treatment with a PPAR-γ Agonist Protects Against Hyperuricemic Nephropathy in a Rat Model.

43). Yang J et al. miR-200b-containing microvesicles attenuate experimental colitis associated intestinal fibrosis by inhibiting epithelial-mesenchymal transition. J Gastroenterol Hepatol 2017 Dec;32(12):1966-1974 (PubMed: 28370348)

Application: WB    Species:rat;    Sample:Not available


No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF7001-BP
(Blocking peptide available as AF7001-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Bovine
100%
Dog
100%
Horse
100%
Chicken
89%
Zebrafish
89%
Xenopus
78%
Rabbit
0%
Sheep
0%
High similarity Medium similarity Low similarity No similarity
P02452/P08123 as Substrate
Site PTM Type Enzyme
K198 Acetylation
T209 Phosphorylation
S251 Phosphorylation
S389 Phosphorylation
S401 Phosphorylation
S404 Phosphorylation
S710 Phosphorylation
T981 Phosphorylation
K1064 Acetylation
T1073 Phosphorylation
S1104 Phosphorylation
S1124 Phosphorylation
T1138 O-Glycosylation
T1138 Phosphorylation
S1141 Phosphorylation
T1148 Phosphorylation
S1155 Phosphorylation
S1295 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top