CD34 Antibody - #DF16119
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
CD34; CD34 antigen; CD34 molecule; CD34_HUMAN; Cluster designation 34; Hematopoietic progenitor cell antigen CD34; HPCA1; Mucosialin; OTTHUMP00000034733; OTTHUMP00000034734;
Immunogens
A synthesized peptide derived from human CD34.
Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues.
- P28906 CD34_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
PTMs - P28906 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S198 | Phosphorylation | Uniprot | |
| K268 | Acetylation | Uniprot | |
| S282 | Phosphorylation | Uniprot | |
| Y286 | Phosphorylation | Uniprot | |
| Y329 | Phosphorylation | Uniprot | |
| Y330 | Phosphorylation | Uniprot | |
| T331 | Phosphorylation | Uniprot | |
| Y339 | Phosphorylation | Uniprot | |
| S341 | Phosphorylation | Uniprot | |
| S346 | Phosphorylation | P31751 (AKT2) | Uniprot |
| S354 | Phosphorylation | Uniprot |
Research Backgrounds
Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins.
Highly glycosylated.
Phosphorylated on serine residues by PKC.
Membrane>Single-pass type I membrane protein.
Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues.
Belongs to the CD34 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.