Product: Phospho-ETS1 (Thr38) Antibody
Catalog: AF3918
Description: Rabbit polyclonal antibody to Phospho-ETS1 (Thr38)
Application: IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 50kD(Calculated).
Uniprot: P14921
RRID: AB_2847641

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-ETS1 (Thr38) Antibody detects endogenous levels of ETS1 only when phosphorylated at Thr38.
RRID:
AB_2847641
Cite Format: Affinity Biosciences Cat# AF3918, RRID:AB_2847641.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Avian erythroblastosis virus E26 (v ets) oncogene homolog 1; C ets 1 protein; c-ets-1; ETS 1; Ets protein; ETS proto-oncogene 1, transcription factor; ETS1; ETS1 oncogene; ETS1 protein; ETS1_HUMAN; EWSR 2; EWSR2; FLJ10768; Oncogene ETS1; P54; Protein C-ets-1; v ets avian erythroblastosis virus E2 oncogene homolog; v ets avian erythroblastosis virus E2 oncogene homolog 1; v ets avian erythroblastosis virus E26 oncogene homolog 1; v ets erythroblastosis virus E26 oncogene homolog 1; v-ets erythroblastosis virus E26 oncogene homolog 1;

Immunogens

Immunogen:

A synthesized peptide derived from human ETS1 around the phosphorylation site of Thr38.

Uniprot:
Gene(ID):
Expression:
P14921 ETS1_HUMAN:

Highly expressed within lymphoid cells. Isoforms c-ETS-1A and Ets-1 p27 are both detected in all fetal tissues tested, but vary with tissue type in adult tissues. None is detected in brain or kidney.

Sequence:
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE

PTMs - P14921 As Substrate

Site PTM Type Enzyme
K2 Acetylation
K2 Ubiquitination
K8 Acetylation
K8 Ubiquitination
K15 Acetylation
K15 Sumoylation
K15 Ubiquitination
K18 Ubiquitination
S26 Phosphorylation
T38 Phosphorylation P28482 (MAPK1) , Q13164 (MAPK7) , P27361 (MAPK3)
S41 Phosphorylation
K42 Ubiquitination
S46 Phosphorylation
K50 Ubiquitination
S54 Phosphorylation
K58 Ubiquitination
K67 Ubiquitination
K97 Ubiquitination
K138 Sumoylation
K138 Ubiquitination
Y140 Phosphorylation
Y158 Phosphorylation
K200 Sumoylation
Y205 Phosphorylation
S207 Phosphorylation
Y223 Phosphorylation
K227 Ubiquitination
T232 Phosphorylation
K245 Acetylation
K245 Ubiquitination
S251 Phosphorylation Q9UQM7 (CAMK2A)
S254 Phosphorylation
S257 Phosphorylation Q9UQM7 (CAMK2A)
Y258 Phosphorylation
S260 Phosphorylation
T265 Phosphorylation
S267 Phosphorylation
S270 Phosphorylation
S272 Phosphorylation
S273 Phosphorylation
S276 Phosphorylation
S282 Phosphorylation Q9UQM7 (CAMK2A)
Y283 Phosphorylation
S285 Phosphorylation Q9UQM7 (CAMK2A)
S288 Phosphorylation
Y291 Phosphorylation
K299 Ubiquitination
K301 Ubiquitination
K305 Acetylation
K305 Ubiquitination
K377 Ubiquitination
K383 Ubiquitination
K388 Sumoylation
K388 Ubiquitination
Y395 Phosphorylation
K399 Ubiquitination
K404 Ubiquitination
T405 Phosphorylation
Y410 Phosphorylation

Research Backgrounds

Function:

Transcription factor. Directly controls the expression of cytokine and chemokine genes in a wide variety of different cellular contexts. May control the differentiation, survival and proliferation of lymphoid cells. May also regulate angiogenesis through regulation of expression of genes controlling endothelial cell migration and invasion.

PTMs:

Sumoylated on Lys-15 and Lys-227, preferentially with SUMO2; which inhibits transcriptional activity.

Ubiquitinated; which induces proteasomal degradation.

Subcellular Location:

Cytoplasm. Nucleus.
Note: Delocalizes from nucleus to cytoplasm when coexpressed with isoform Ets-1 p27.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed within lymphoid cells. Isoforms c-ETS-1A and Ets-1 p27 are both detected in all fetal tissues tested, but vary with tissue type in adult tissues. None is detected in brain or kidney.

Subunit Structure:

Binds DNA as a homodimer; homodimerization is required for transcription activation. Interacts with MAF and MAFB. Interacts with PAX5; the interaction alters DNA-binding properties (By similarity). Interacts with DAXX. Interacts with UBE2I. Interacts with SP100; the interaction is direct and modulates ETS1 transcriptional activity.

Family&Domains:

Belongs to the ETS family.

Research Fields

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Renal cell carcinoma.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.