Price Size
$280 100ul
$350 200ul

Same day delivery

Contact distributor
  • Product Name
    Bcl-2 Antibody
  • Catalog No.
    AF6139
  • RRID
    AB_2835021
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA
  • Reactivity
    Human, Mouse, Rat, Chinese Mitten Crab
  • Prediction
    Horse(100%), Dog(86%)
  • UniProt
  • Mol.Wt
    26kD;
    26kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

Apoptosis regulator Bcl 2; Apoptosis regulator Bcl-2; Apoptosis regulator Bcl2; AW986256; B cell CLL/lymphoma 2; B cell leukemia/lymphoma 2; Bcl-2; Bcl2; BCL2_HUMAN; C430015F12Rik; D630044D05Rik; D830018M01Rik; Leukemia/lymphoma, B-cell, 2; Oncogene B-cell leukemia 2; PPP1R50; Protein phosphatase 1, regulatory subunit 50;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000

Reactivity:

Human, Mouse, Rat, Chinese Mitten Crab

Predicted Reactivity:

Horse(100%), Dog(86%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

Bcl-2 Antibody detects endogenous levels of total Bcl-2.

RRID:

AB_2835021
Please cite this product as: Affinity Biosciences Cat# AF6139, RRID:AB_2835021.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

A synthesized peptide derived from human Bcl-2, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

BCL2

Molecular Weight:

Observed Mol.Wt.: 26kD.
Predicted Mol.Wt.: 26kDa(Calculated)..

Subcellular Location:

Mitochondrion outer membrane. Nucleus membrane. Endoplasmic reticulum membrane.

Tissue Specificity:

P10415 BCL2_HUMAN:
Expressed in a variety of tissues.

Description:

This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends.

Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Research Background

Function:

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed:17418785).

Post-translational Modifications:

Phosphorylation/dephosphorylation on Ser-70 regulates anti-apoptotic activity. Growth factor-stimulated phosphorylation on Ser-70 by PKC is required for the anti-apoptosis activity and occurs during the G2/M phase of the cell cycle. In the absence of growth factors, BCL2 appears to be phosphorylated by other protein kinases such as ERKs and stress-activated kinases. Phosphorylated by MAPK8/JNK1 at Thr-69, Ser-70 and Ser-87, wich stimulates starvation-induced autophagy. Dephosphorylated by protein phosphatase 2A (PP2A) (By similarity).

Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity, causes the release of cytochrome c into the cytosol promoting further caspase activity.

Monoubiquitinated by PRKN, leading to increase its stability. Ubiquitinated by SCF(FBXO10), leading to its degradation by the proteasome.

Subcellular Location:

Mitochondrion outer membrane>Single-pass membrane protein. Nucleus membrane>Single-pass membrane protein. Endoplasmic reticulum membrane>Single-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Expressed in a variety of tissues.

Subunit Structure:

Forms homodimers, and heterodimers with BAX, BAD, BAK and Bcl-X(L). Heterodimerization with BAX requires intact BH1 and BH2 motifs, and is necessary for anti-apoptotic activity (PubMed:8183370). Interacts with EI24 (By similarity). Also interacts with APAF1, BBC3, BCL2L1, BNIPL, MRPL41 and TP53BP2. Binding to FKBP8 seems to target BCL2 to the mitochondria and probably interferes with the binding of BCL2 to its targets. Interacts with BAG1 in an ATP-dependent manner. Interacts with RAF1 (the 'Ser-338' and 'Ser-339' phosphorylated form). Interacts (via the BH4 domain) with EGLN3; the interaction prevents the formation of the BAX-BCL2 complex and inhibits the anti-apoptotic activity of BCL2. Interacts with G0S2; this interaction also prevents the formation of the anti-apoptotic BAX-BCL2 complex. Interacts with RTL10/BOP. Interacts with the SCF(FBXO10) complex. Interacts (via the loop between motifs BH4 and BH3) with NLRP1 (via LRR repeats), but not with NLRP2, NLRP3, NLRP4, PYCARD, nor MEFV (PubMed:17418785). Interacts with GIMAP3/IAN4, GIMAP4/IAN1 and GIMAP5/IAN5 (By similarity).

Similarity:

BH1 and BH2 domains are required for the interaction with BAX and for anti-apoptotic activity.

The BH4 motif is required for anti-apoptotic activity and for interaction with RAF1 and EGLN3.

The loop between motifs BH4 and BH3 is required for the interaction with NLRP1.

Belongs to the Bcl-2 family.

Research Fields

Research Fields:

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.(View pathway)
· Cellular Processes > Cell growth and death > Apoptosis.(View pathway)
· Cellular Processes > Transport and catabolism > Autophagy - animal.(View pathway)
· Cellular Processes > Cell growth and death > Apoptosis - multiple species.(View pathway)
· Cellular Processes > Cell growth and death > Necroptosis.(View pathway)
· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Hedgehog signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.(View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum.(View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Gastric cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Colorectal cancer.(View pathway)
· Human Diseases > Cancers: Overview > MicroRNAs in cancer.
· Human Diseases > Cancers: Specific types > Small cell lung cancer.(View pathway)
· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.
· Human Diseases > Cancers: Specific types > Prostate cancer.(View pathway)
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.(View pathway)
· Organismal Systems > Nervous system > Neurotrophin signaling pathway.(View pathway)
· Organismal Systems > Nervous system > Cholinergic synapse.
· Organismal Systems > Immune system > NOD-like receptor signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Estrogen signaling pathway.(View pathway)

Reference Citations:

1). Li X et al. Cyanidin-3-O-glucoside restores spermatogenic dysfunction in cadmium-exposed pubertal mice via histone ubiquitination and mitigating oxidative damage. J Hazard Mater 2019 Nov 17:121706 (PubMed: 31796358) [IF=9.038]

2). Zhou Q;Pan LL;Xue R;Ni G;Duan Y;Bai Y;Shi C;Ren Z;Wu C;Li G;Agerberth B;Sluijter JP;Sun J;Xiao J; et al. The anti-microbial peptide LL-37/CRAMP levels are associated with acute heart failure and can attenuate cardiac dysfunction in multiple preclinical models of heart failure. Theranostics 2020 May 15;10(14):6167-6181. (PubMed: 32483446) [IF=8.579]

3). Yin L et al. Bacillus spore-based oral carriers loading curcumin for the therapy of colon cancer. J Control Release 2018 Feb 10;271:31-44 (PubMed: 29274436) [IF=7.727]

4). Fan H et al. Bacteroides fragilis Strain ZY-312 Defense against Cronobacter sakazakii-Induced Necrotizing Enterocolitis In Vitro and in a Neonatal Rat Model. mSystems 2019 Aug 6;4(4) (PubMed: 31387931) [IF=6.633]

5). Li Z et al. The interaction of Atg4B and Bcl-2 plays an important role in Cd-induced crosstalk between apoptosis and autophagy through disassociation of Bcl-2-Beclin1 in A549 cells. Free Radic Biol Med 2018 Nov 17 (PubMed: 30458278) [IF=6.170]

6). Mengyang Zhao et al. Packaging cordycepin phycocyanin micelles for the inhibition of brain cancer. J. Mater. Chem. B 2017;5:6016-6026 [IF=5.344]

7). Yarong Du et al. The Reduced Oligomerization of MAVS Mediated by ROS Enhances the Cellular Radioresistance. OXID MED CELL LONGEV 2020 Mar 4;Article ID 2167129 [IF=5.076]

8). Qi L et al. Curcumin Protects Human Trophoblast HTR8/SVneo Cells from H2O2-Induced Oxidative Stress by Activating Nrf2 Signaling Pathway. Antioxidants (Basel) 2020 Feb 1;9(2) (PubMed: 32024207) [IF=5.014]

9). Zhou H et al. Oxidative DNA damage and multi-organ pathologies in male mice subchronically treated with aflatoxin B1. Ecotoxicol Environ Saf 2019 Oct 17;186:109697 (PubMed: 31629905) [IF=4.872]

10). Li S;Lu Y;Ding D;Ma Z;Xing X;Hua X;Xu J; et al. Fibroblast growth factor 2 contributes to the effect of salidroside on dendritic and synaptic plasticity after cerebral ischemia/reperfusion injury. Aging (Albany NY) 2020 Jun 9;12. (PubMed: 32518214) [IF=4.831]

11). Meng X;Zhang J;Wu H;Yu D;Fang X; et al. Akkermansia muciniphila Aspartic Protease Amuc_1434* Inhibits Human Colorectal Cancer LS174T Cell Viability via TRAIL-Mediated Apoptosis Pathway. Int J Mol Sci 2020 May 11;21(9):E3385. (PubMed: 32403433) [IF=4.556]

12). Yu Z;Li Q;Wang Y;Li P; et al. A Potent Protective Effect of Baicalein on Liver Injury by Regulating Mitochondria-Related Apoptosis. Apoptosis 2020 May 14. (PubMed: 32409930) [IF=4.543]

13). Zhang M et al. Inhibition of PHLPP1 ameliorates cardiac dysfunction via activation of the PI3K/Akt/mTOR signalling pathway in diabetic cardiomyopathy. J Cell Mol Med 2020 Mar 9 (PubMed: 32150791) [IF=4.486]

14). Liu H et al. Long non-coding RNA MALAT1 mediates hypoxia-induced pro-survival autophagy of endometrial stromal cells in endometriosis. J Cell Mol Med 2019 Jan;23(1):439-452 (PubMed: 30324652) [IF=4.486]

15). Liu H et al. Long non-coding RNA MALAT1 mediates hypoxia-induced pro-survival autophagy of endometrial stromal cells in endometriosis. J Cell Mol Med 2019 Jan;23(1):439-452 (PubMed: 30324652) [IF=4.486]

16). Wang N;Xu P;Wang X;Yao W;Wang B;Wu Y;Shou D; et al. Timosaponin AIII attenuates inflammatory injury in AGEs-induced osteoblast and alloxan-induced diabetic osteoporosis zebrafish by modulating the RAGE/MAPK signaling pathways. Phytomedicine 2020 May 24;75:153247. (PubMed: 32502823) [IF=4.268]

17). Xu K;Mo Y;Li D;Yu Q;Wang L;Lin F;Kong C;Balelang MF;Zhang A;Chen S;Dai Q;Wang J; et al. N6-methyladenosine demethylases Alkbh5/Fto regulate cerebral ischemia-reperfusion injury. Ther Adv Chronic Dis 2020 Apr 29;11:2040622320916024. (PubMed: 32426101) [IF=4.257]

18). Zhu H et al. Synthesis of Chalcone Derivatives: Inducing Apoptosis of HepG2 Cells via Regulating Reactive Oxygen Species and Mitochondrial Pathway. Front Pharmacol 2019 Nov 15;10:1341 (PubMed: 31803052) [IF=4.225]

19). Dai Z et al. Carnosine ameliorates age-related dementia via improving mitochondrial dysfunction in SAMP8 mice. Food Funct 2020 Mar 5 (PubMed: 32134423) [IF=4.171]

20). Liu Y et al. Oligo-Porphyran Ameliorates Neurobehavioral Deficits in Parkinsonian Mice by Regulating the PI3K/Akt/Bcl-2 Pathway. Mar Drugs 2018 Mar 6;16(3) (PubMed: 29509717) [IF=4.073]

21). Lu Q et al. The mTOR promotes oxidative stress-induced apoptosis of mesangial cells in diabetic nephropathy. Mol Cell Endocrinol 2018 Sep 15;473:31-43 (PubMed: 29277549) [IF=3.871]

22). Zhai Z et al. Andrographolide prevents human breast cancer-induced osteoclastic bone loss via attenuated RANKL signaling. Breast Cancer Res Treat 2014 Feb;144(1):33-45 (PubMed: 24481680) [IF=3.831]

23). Jing-JingYang et al. Astragaloside IV enhances GATA-4 mediated myocardial protection effect in Hypoxia/Reoxygenation injured H9c2 cells. NUTR METAB CARDIOVAS 2020 Jan 16 [IF=3.700]

24). Chen Y et al. Iridoid glycoside from Cornus officinalis ameliorated diabetes mellitus-induced testicular damage in male rats: Involvement of suppression of the AGEs/RAGE/p38 MAPK signaling pathway. J Ethnopharmacol 2016 Dec 24;194:850-860 (PubMed: 27989876) [IF=3.690]

Application: WB    Species:rat;    Sample:Not available

(G-H) Western blot analyses of Bax and Bcl-2 protein expressions in testis homogenates.


25). Yang Q et al. Yinning Tablet, a hospitalized preparation of Chinese herbal formula for hyperthyroidism, ameliorates thyroid hormone-induced liver injury in rats: Regulation of mitochondria-mediated apoptotic signals. J Ethnopharmacol 2020 Jan 28;252:112602 (PubMed: 32004632) [IF=3.690]

26). Zhou J et al. MicroRNA-145 overexpression attenuates apoptosis and increases matrix synthesis in nucleus pulposus cells. Life Sci 2019 Feb 20 (PubMed: 30797016) [IF=3.647]

27). Li F et al. Icariin improves the cognitive function of APP/PS1 mice via suppressing endoplasmic reticulum stress. Life Sci 2019 Aug 7:116739 (PubMed: 31400352) [IF=3.647]

28). Zhao ZH et al. PirB Overexpression Exacerbates Neuronal Apoptosis by Inhibiting TrkB and mTOR Phosphorylation After Oxygen and Glucose Deprivation Injury. Cell Mol Neurobiol 2017 May;37(4):707-715 (PubMed: 27443384) [IF=3.606]

Application: WB    Species:mouse;    Sample:Not available


29). Tu X et al. Pretreatment of Grape Seed Proanthocyanidin Extract Exerts Neuroprotective Effect in Murine Model of Neonatal Hypoxic-ischemic Brain Injury by Its Antiapoptotic Property. Cell Mol Neurobiol 2019 May 30 (PubMed: 31147852) [IF=3.606]

30). Liu JD et al. Dietary glutathione supplementation enhances antioxidant activity and protects against lipopolysaccharide-induced acute hepatopancreatic injury and cell apoptosis in Chinese mitten crab, Eriocheir sinensis. Fish Shellfish Immunol 2019 Dec 16;97:440-454 (PubMed: 31857224) [IF=3.298]

31). Jiang W et al. Inhibiting PKCβ2 protects HK-2 cells against meglumine diatrizoate and AGEs-induced apoptosis and autophagy. Ann Transl Med 2020 Mar;8(6):293 (PubMed: 32355737) [IF=3.297]

32). Huang X et al. SU5416 attenuated lipopolysaccharide-induced acute lung injury in mice by modulating properties of vascular endothelial cells. Drug Des Devel Ther 2019 May 23;13:1763-1772 (PubMed: 31213766) [IF=3.216]

33). Li A et al. NUPR1 Silencing Induces Autophagy-Mediated Apoptosis in Multiple Myeloma Cells Through the PI3K/AKT/mTOR Pathway. DNA Cell Biol 2020 Jan 22 (PubMed: 31971825) [IF=3.191]

34). Li XG et al. Neuroprotective effects of rapamycin on spinal cord injury in rats by increasing autophagy and Akt signaling. Neural Regen Res 2019 Apr;14(4):721-727 (PubMed: 30632514) [IF=3.171]

35). Zhou Y et al. Combination Therapy With Hyperbaric Oxygen and Erythropoietin Inhibits Neuronal Apoptosis and Improves Recovery in Rats With Spinal Cord Injury. Phys Ther 2019 Sep 2 (PubMed: 31504911) [IF=3.140]

36). Hu L et al. Tri-ortho-cresyl phosphate (TOCP) induced ovarian failure in mice is related to the Hippo signaling pathway disruption. Reprod Toxicol 2018 Nov 12 (PubMed: 30439503) [IF=3.121]

37). Liao ZL et al. Salidroside protects PC-12 cells against amyloid β-induced apoptosis by activation of the ERK1/2 and AKT signaling pathways. Int J Mol Med 2019 Feb 1 (PubMed: 30720058) [IF=3.098]

38). Yang M et al. Estrogen receptor β exhibited anti-tumor effects on osteosarcoma cells by regulating integrin, IAP, NF-kB/BCL-2 and PI3K/Akt signal pathway. J Bone Oncol 2017 Sep 28;9:15-20 (PubMed: 29071206) [IF=3.066]

Application: WB    Species:human;    Sample:Not available

Fig 5. The expression of p-p65, p-AKT and Bcl-2 (protein level) in U2-OS cells treated by LY294002 or/and Estrogen receptor β (ERβ) siRNA in the presence of 10-10 M E2.


39). Minfei Yang et al. Estrogen receptor β exhibited anti-tumor effects on osteosarcoma cells by regulating integrin, IAP, NFkB/BCL-2 and PI3K/Akt signal pathway. Journal of Bone Oncology 2017 Sep;9:15-20 [IF=3.066]

40). Liu Y et al. Fucoxanthin Activates Apoptosis via Inhibition of PI3K/Akt/mTOR Pathway and Suppresses Invasion and Migration by Restriction of p38-MMP-2/9 Pathway in Human Glioblastoma Cells. Neurochem Res 2016 Oct;41(10):2728-2751 (PubMed: 27394418) [IF=3.038]

Application: WB    Species:human;    Sample:u87

Cell lysates were electrophoresed and apoptotic proteins were detected by their respective specific antibodies in indicated concentrations. Each bar represents the mean±SEM in triplicate experiments


41). Luo HM et al. Calcitonin gene-related peptide attenuates angiotensin II-induced ROS-dependent apoptosis in vascular smooth muscle cells by inhibiting the CaMKII/CREB signalling pathway. Biochem Biophys Res Commun 2019 Oct 23 (PubMed: 31668374)

42). Shao Q et al. MicroRNA-139-5p affects cisplatin sensitivity in human nasopharyngeal carcinoma cells by regulating the epithelial-to-mesenchymal transition. Gene 2018 Apr 30;652:48-58 (PubMed: 29427737)

43). Pan L et al. The cardiac glycoside oleandrin induces apoptosis in human colon cancer cells via the mitochondrial pathway. Cancer Chemother Pharmacol 2017 Jul;80(1):91-100 (PubMed: 28597038)

Application: WB    Species:human;    Sample:SW480


44). Chen W et al. MicroRNA-214 protects L6 skeletal myoblasts against hydrogen peroxide-induced apoptosis. Free Radic Res 2020 Mar 5:1-11 (PubMed: 32131653)

45). Wang R et al. MicroRNA-210 regulates human trophoblast cell line HTR-8/SVneo function by attenuating Notch1 expression: Implications for the role of microRNA-210 in pre-eclampsia. Mol Reprod Dev 2019 May 21 (PubMed: 31115130)

46). Li H et al. The effect of cavernous nerve traction on erectile function in rats. PLoS One 2017 Oct 5;12(10):e0186077 (PubMed: 28982169)

Application: WB    Species:rat;    Sample:Not available

Fig 6. Changes of the apoptosis in corpus cavernosum. (A) The expression of Bcl-2 and Bax detected by western blot. (B) Ratio of Bax to Bcl-2. Data are shown as the fold changes over the control group. (C) Bar graph depicts caspase3 activity in penile tissues measured by a Caspase3 Activity Assay Kit, which was calculated according to a standard curve and normalized by the protein concentration. N = 6 in each group. * P<0.05 compared with control group. # P<0.05 compared with 2-min CN crush group.


47). Zhu L et al. Transcription factorIRX5 promotes hepatocellular carcinoma proliferation and inhibits apoptosis by regulating the p53 signalling pathway. Cell Biochem Funct 2020 Mar 9 (PubMed: 32153043)

48). Zhou Y et al. Altered Light Conditions Contribute to Abnormalities in Emotion and Cognition Through HINT1 Dysfunction in C57BL/6 Mice. Front Behav Neurosci 2018 Jun 8;12:110 (PubMed: 29937721)

49). Cui K et al. Human tissue kallikrein-1 protects against the development of erectile dysfunction in a rat model of hyperhomocysteinemia. Asian J Androl 2019 Jan 1 (PubMed: 30618416)

50). Li R et al. Curcumin ameliorates atrophy of seminal vesicle via reduction of oxidative stress in castrated mice. PeerJ 2019 Jul 5;7:e7192 (PubMed: 31316871)

51). Li R et al. Curcumin ameliorates atrophy of seminal vesicle via reduction of oxidative stress in castrated mice. PeerJ 2019 Jul 5;7:e7192 (PubMed: 31316871)

52). Wan GX et al. MiR-15b-5p is Involved in Doxorubicin-Induced Cardiotoxicity via Inhibiting Bmpr1a Signal in H9c2 Cardiomyocyte. Cardiovasc Toxicol 2018 Dec 7 (PubMed: 30535663)

53). Shang J et al. CircPAN3 contributes to drug resistance in acute myeloid leukemia through regulation of autophagy. Leuk Res 2019 Aug 2;85:106198 (PubMed: 31401408)

54). Zhang SH et al. Ferulic acid ameliorates pentylenetetrazol-induced seizures by reducing neuron cell death. Epilepsy Res 2019 Aug 5;156:106183 (PubMed: 31404716)

55). Wang F et al. Angelicin inhibits liver cancer growth in vitro and in vivo. Mol Med Rep 2017 Oct;16(4):5441-5449 (PubMed: 28849216)

Application: WB    Species:human;    Sample:Not available


56). Li Y et al. Theaflavic acid from black tea protects PC12 cells against ROS-mediated mitochondrial apoptosis induced by OGD/R via activating Nrf2/ARE signaling pathway. J Nat Med 2019 Jun 21 (PubMed: 31227974)

57). Li R et al. Hyperlipidemia impairs erectile function in rats by causing cavernosal fibrosis. Andrologia 2017 Sep;49(7) (PubMed: 27619893)

Application: WB    Species:rat;    Sample:Not available

Western blot analysis of the expression of Bcl-2 and Bax, normalized to the β-actin level, in the control and hyperlipidemia groups.


58). Kan J;Huang H;Jiang Z;Zhou R;Bai S;Liao C;Chen J;Dong J;Zhang Y;Zhang J;Zhang R;Zhou D;Zhang E; et al. Arenobufagin Promoted Oxidative Stress-Associated Mitochondrial Pathway Apoptosis in A549 Non-Small-Cell Lung Cancer Cell Line. Evid Based Complement Alternat Med 2020 Apr 22;2020:8909171. (PubMed: 32382311)

59). Huankai Yao et al. Protective effects of hederagenic acid on PC12 cells against the OGD/R-induced apoptosis via activating Nrf2/ARE signaling pathway. Med Chem Res 2020 Jan

60). Gao Y et al. Betulinic acid induces apoptosis and ultrastructural changes in MDA-MB-231 breast cancer cells. Ultrastruct Pathol 2018 Jan-Feb;42(1):49-54 (PubMed: 29192840)

61). Agbo E et al. Modulation of PTEN by hexarelin attenuates coronary artery ligation-induced heartfailure in rats. Turk J Med Sci 2019 May 16;49(3) (PubMed: 31091855)

62). Wang H et al. Baicalin extracted from Huangqin (Radix Scutellariae Baicalensis) induces apoptosis in gastric cancer cells by regulating B cell lymphoma (Bcl-2)/Bcl-2-associated X protein and activating caspase-3 and caspase-9. J Tradit Chin Med 2017 Apr;37(2):229-5 (PubMed: 29960296)

63). et al. Effects of Sancai Lianmei Particle on autophagy and apoptosis in testes of diabetic mice via the Nrf2/HO-1 pathway. Int J Clin Exp Med 2019;12(6):6720-6732

64). Liu QQ et al. Differential gene and lncRNA expression in the lower thoracic spinal cord following ischemia/reperfusion-induced acute kidney injury in rats. Oncotarget 2017 Jun 20;8(32):53465-53481 (PubMed: 28881824)

Application: WB    Species:rat;    Sample:Not available

Figure 7: Validation of differential expression mRNAs and lncRNAs in spinal cord by real time RT-qPCR and Western blot analysis. (A) The differential expression mRNA levels were validated by qRT-PCR. (B) Five upregulated lncRNAs and fve downregulated lncRNAs were validated by qRT-PCR. The levels of mRNAs and lncRNAs were normalized to GAPDH and expressed as fold of change compared to sham group. The results represent the mean± SEM of three independent experiments. *p < 0.05; **p < 0.01 compared with the sham group. Western blot analysis shown protein expression levels of Akt, P-Akt (C), Bcl-2, Caspase-3 (D), P2X7R, S100A9, Bax (E). Each bar represents the mean ± SEM for at least 6 animals.


65). Yang M et al. Estrogen receptor β exhibited anti-tumor effects on osteosarcoma cells by regulating integrin, IAP, NF-kB/BCL-2 and PI3K/Akt signal pathway. J Bone Oncol 2017 Sep 28;9:15-20 (PubMed: 29071206)

Application: WB    Species:human;    Sample:Not available

Fig 5. The expression of p-p65, p-AKT and Bcl-2 (protein level) in U2-OS cells treated by LY294002 or/and Estrogen receptor β (ERβ) siRNA in the presence of 10-10 M E2.


66). Xiangli Yan et al. Calycosin-7-O-β-D-glucoside Attenuates OGD/R-Induced Damage by Preventing Oxidative Stress and Neuronal Apoptosis via the SIRT1/FOXO1/PGC-1α Pathway in HT22 Cells. NEURAL PLAST 2019, Article ID 8798069, 11 pages

67). Liu J et al. Irisin Enhances Doxorubicin-Induced Cell Apoptosis in Pancreatic Cancer by Inhibiting the PI3K/AKT/NF-κB Pathway. Med Sci Monit 2019 Aug 14;25:6085-6096 (PubMed: 31412018)

68). Wang W et al. Mitofusin-2 Triggers Cervical Carcinoma Cell Hela Apoptosis via Mitochondrial Pathway in Mouse Model. Cell Physiol Biochem 2018;46(1):69-81 (PubMed: 29587277)

69). Zhang Y et al. Treatment of diabetes mellitus-induced erectile dysfunction using endothelial progenitor cells genetically modified with human telomerase reverse transcriptase. Oncotarget 2016 Jun 28;7(26):39302-39315 (PubMed: 27283992)

Application: WB    Species:rat;    Sample:Not available

(C) Western blotting was used to evaluate the expression of Bcl-2 and Bax.


70). et al. Inhibition of Fatty Acid Synthase (FASN) Affects the Proliferation and Apoptosis of HepG2 Hepatoma Carcinoma Cells via the β-catenin/C-myc Signaling Pathway.

71). et al. Effects and Mechanisms of Vitamin C Post-Conditioning on Platelet Activation after Hypoxia/Reoxygenation.

72). Gong L;He J;Sun X;Li L;Zhang X;Gan H; et al. Activation of sirtuin1 protects against ischemia/reperfusion-induced acute kidney injury. Biomed Pharmacother 2020 May;125:110021. (PubMed: 32092826)

73). et al. Regulation of RUNX3 expression by DNA methylation in prostate cancer.

74). et al. Ginsenoside Rg1 protects against aging-induced renal interstitial fibrosis due to inhibition of tubular epithelial cells endoplasmic reticulum stress in SAMP8 mice.

75). et al. The role of Apatinib combined with Paclitaxel (aluminum binding type) in drug-resistant ovarian cancer.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF6139-BP
(Blocking peptide available as AF6139-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Horse
100%
Dog
86%
Chicken
0%
Rabbit
0%
Zebrafish
0%
Xenopus
0%
Sheep
0%
Pig
0%
Bovine
0%
High similarity Medium similarity Low similarity No similarity
P10415 as Substrate
Site PTM Type Enzyme
Y9 Phosphorylation
K22 Ubiquitination
S24 Phosphorylation
T56 Phosphorylation Q16539 (MAPK14) , P06493 (CDK1) , P53779 (MAPK10) , P28482 (MAPK1) , P27361 (MAPK3)
T69 Phosphorylation P45983 (MAPK8)
S70 Phosphorylation P27361 (MAPK3) , P06493 (CDK1) , P53779 (MAPK10) , P17252 (PRKCA) , Q00534 (CDK6) , P28482 (MAPK1) , P45983 (MAPK8)
T74 Phosphorylation P28482 (MAPK1) , P53779 (MAPK10) , P27361 (MAPK3)
S87 Phosphorylation Q16539 (MAPK14) , P45983 (MAPK8) , Q00534 (CDK6) , P27361 (MAPK3) , P28482 (MAPK1) , P53779 (MAPK10)
C158 S-Nitrosylation
C229 S-Nitrosylation
Y235 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top