Product: Phospho-ICK (Tyr159) Antibody
Catalog: AF3816
Description: Rabbit polyclonal antibody to Phospho-ICK (Tyr159)
Application: WB ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 71kD(Calculated).
Uniprot: Q9UPZ9
RRID: AB_2847130

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-ICK (Tyr159) Antibody detects endogenous levels of ICK only when phosphorylated at Tyr159.
RRID:
AB_2847130
Cite Format: Affinity Biosciences Cat# AF3816, RRID:AB_2847130.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2210420N10Rik; AI848300; ECO; Heart serine threonine protein kinase; hICK; Intestinal cell (MAK like) kinase; Intestinal cell kinase; KIAA0936; Laryngeal cancer kinase 2; LCK2; MAK related kinase; MGC46090; mICK; MRK; OTTMUSP00000041856; OTTMUSP00000041857; Serine/threonine protein kinase ICK;

Immunogens

Immunogen:

A synthesized peptide derived from human ICK around the phosphorylation site of Tyr159.

Uniprot:
Gene(ID):
Expression:
Q9UPZ9 CILK1_HUMAN:

Expressed in heart, brain, placenta, pancreas, thymus, prostate, testis, ovary, small intestine and colon, with highest levels in placenta and testis. Not detected in spleen. Also expressed in many cancer cell lines.

Sequence:
MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALRYPYFQVGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWADLDDLDFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSSSTSSSGLTGNYVPSFLKKEIGSAMQRVHLAPIPDPSPGYSSLKAMRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRTDWASKYASRR

PTMs - Q9UPZ9 As Substrate

Site PTM Type Enzyme
T6 Phosphorylation
T14 Phosphorylation
Y15 Phosphorylation
S17 Phosphorylation
S23 Phosphorylation
S53 Phosphorylation
K56 Ubiquitination
Y156 Phosphorylation
T157 Phosphorylation P50613 (CDK7) , Q8IZL9 (CDK20)
Y159 Phosphorylation Q9UPZ9 (ICK)
Y177 Phosphorylation
T248 Phosphorylation
S254 Phosphorylation
T463 Phosphorylation
T478 Phosphorylation
K491 Methylation
S520 Phosphorylation
S528 Phosphorylation
S529 Phosphorylation
K562 Acetylation
Y583 Phosphorylation
S585 Phosphorylation

PTMs - Q9UPZ9 As Enzyme

Substrate Site Source
P46379 (BAG6) T1080 Uniprot
Q8N122 (RPTOR) T908 Uniprot
Q9UPZ9 (ICK) Y159 Uniprot

Research Backgrounds

Function:

Required for ciliogenesis. Phosphorylates KIF3A (By similarity). Involved in the control of ciliary length. Regulates the ciliary localization of SHH pathway components as well as the localization of IFT components at ciliary tips (By similarity). May play a key role in the development of multiple organ systems and particularly in cardiac development (By similarity). Regulates intraflagellar transport (IFT) speed and negatively regulates cilium length in a cAMP and mTORC1 signaling-dependent manner and this regulation requires its kinase activity (By similarity).

PTMs:

Autophosphorylated on serine and threonine residues. Phosphorylation at Thr-157 increases kinase activity.

Subcellular Location:

Nucleus. Cytoplasm>Cytosol. Cell projection>Cilium. Cytoplasm>Cytoskeleton>Cilium basal body.
Note: Also found at the ciliary tip (PubMed:24797473). Nuclear localization has been observed with a GFP-tagged construct in transfected HeLa cells (PubMed:12103360, PubMed:19185282).

Cytoplasm.
Note: Predominant cytoplasmic localization has been observed with a N-terminally GFP-tagged construct.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in heart, brain, placenta, pancreas, thymus, prostate, testis, ovary, small intestine and colon, with highest levels in placenta and testis. Not detected in spleen. Also expressed in many cancer cell lines.

Family&Domains:

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.