Product: gamma Synuclein Antibody
Catalog: AF0258
Description: Rabbit polyclonal antibody to gamma Synuclein
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 20kDa; 13kD(Calculated).
Uniprot: O76070
RRID: AB_2833433

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
gamma Synuclein Antibody detects endogenous levels of total gamma Synuclein.
RRID:
AB_2833433
Cite Format: Affinity Biosciences Cat# AF0258, RRID:AB_2833433.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BCSG1; Breast cancer specific gene 1 protein; Breast cancer specific protein 1; Breast cancer-specific gene 1 protein; Gamma synuclein; Gamma-synuclein; Persyn; PRSN; SNCG; SR; Synoretin; Synuclein gamma; synuclein, gamma (breast cancer-specific protein 1); SYUG_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human gamma Synuclein, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
O76070 SYUG_HUMAN:

Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung.

Description:
SNCG a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. May be involved in modulating axonal architecture during development and in the adult. Plays a role in neurofilament network integrity. High levels have been identified in advanced breast carcinomas.
Sequence:
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

PTMs - O76070 As Substrate

Site PTM Type Enzyme
K5 Methylation
K6 Methylation
S9 Phosphorylation
Y39 Phosphorylation
T44 Phosphorylation
S51 Phosphorylation
S54 Phosphorylation
K58 Acetylation
S112 Phosphorylation
S124 Phosphorylation P34947 (GRK5)

Research Backgrounds

Function:

Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway (By similarity).

PTMs:

Phosphorylated. Phosphorylation by GRK5 appears to occur on residues distinct from the residue phosphorylated by other kinases.

Subcellular Location:

Cytoplasm>Perinuclear region. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Spindle.
Note: Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung.

Subunit Structure:

May be a centrosome-associated protein. Interacts with MYOC; affects its secretion and its aggregation (By similarity).

Family&Domains:

Belongs to the synuclein family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.