gamma Synuclein Antibody - #AF0258
Product: | gamma Synuclein Antibody |
Catalog: | AF0258 |
Description: | Rabbit polyclonal antibody to gamma Synuclein |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 20kDa; 13kD(Calculated). |
Uniprot: | O76070 |
RRID: | AB_2833433 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0258, RRID:AB_2833433.
Fold/Unfold
BCSG1; Breast cancer specific gene 1 protein; Breast cancer specific protein 1; Breast cancer-specific gene 1 protein; Gamma synuclein; Gamma-synuclein; Persyn; PRSN; SNCG; SR; Synoretin; Synuclein gamma; synuclein, gamma (breast cancer-specific protein 1); SYUG_HUMAN;
Immunogens
A synthesized peptide derived from human gamma Synuclein, corresponding to a region within C-terminal amino acids.
Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung.
- O76070 SYUG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
PTMs - O76070 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K5 | Methylation | Uniprot | |
K6 | Methylation | Uniprot | |
S9 | Phosphorylation | Uniprot | |
Y39 | Phosphorylation | Uniprot | |
T44 | Phosphorylation | Uniprot | |
S51 | Phosphorylation | Uniprot | |
S54 | Phosphorylation | Uniprot | |
K58 | Acetylation | Uniprot | |
S112 | Phosphorylation | Uniprot | |
S124 | Phosphorylation | P34947 (GRK5) | Uniprot |
Research Backgrounds
Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway (By similarity).
Phosphorylated. Phosphorylation by GRK5 appears to occur on residues distinct from the residue phosphorylated by other kinases.
Cytoplasm>Perinuclear region. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Spindle.
Note: Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle.
Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung.
May be a centrosome-associated protein. Interacts with MYOC; affects its secretion and its aggregation (By similarity).
Belongs to the synuclein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.