Product: Phospho-MARCKS (Ser46) Antibody
Catalog: AF3685
Description: Rabbit polyclonal antibody to Phospho-MARCKS (Ser46)
Application: ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 32kD(Calculated).
Uniprot: P29966
RRID: AB_2846999

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-MARCKS (Ser46) Antibody detects endogenous levels of MARCKS only when phosphorylated at Ser46.
RRID:
AB_2846999
Cite Format: Affinity Biosciences Cat# AF3685, RRID:AB_2846999.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

80 kDa protein; 80K L; 80K L protein; 80K-L protein; 80KL; 81 kDa protein, light chain; light chain; MACS; MARCKS; MARCS; MARCS_HUMAN; MGC52672; myristoylated alanine rich C kinase substrate; Myristoylated alanine rich protein kinase C substrate (MARCKS, 80K L); Myristoylated alanine rich protein kinase C substrate; Myristoylated alanine-rich C-kinase substrate; Phosphomyristin; PKCSL; PRKCSL; protein kinase C substrate 80 kDa protein light chain; Protein kinase C substrate;

Immunogens

Immunogen:

A synthesized peptide derived from human MARCKS around the phosphorylation site of Ser46.

Uniprot:
Gene(ID):
Sequence:
MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAPAADKEEPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVEKEAPAEGEAAEPGSPTAAEGEAASAASSTSSPKAEDGATPSPSNETPKKKKKRFSFKKSFKLSGFSFKKNKKEAGEGGEAEAPAAEGGKDEAAGGAAAAAAEAGAASGEQAAAPGEEAAAGEEGAAGGDPQEAKPQEAAVAPEKPPASDETKAAEEPSKVEEKKAEEAGASAAACEAPSAAGPGAPPEQEAAPAEEPAAAAASSACAAPSQEAQPECSPEAPPAEAAE

PTMs - P29966 As Substrate

Site PTM Type Enzyme
G2 Myristoylation
K11 Ubiquitination
S26 Phosphorylation P24941 (CDK2)
S27 Phosphorylation P24941 (CDK2) , P17252 (PRKCA)
S29 Phosphorylation
K30 Ubiquitination
S46 Phosphorylation P17252 (PRKCA)
S52 Phosphorylation
K55 Ubiquitination
S63 Phosphorylation
K69 Ubiquitination
S77 Phosphorylation
S81 Phosphorylation P17252 (PRKCA)
S83 Phosphorylation
K87 Ubiquitination
S101 Phosphorylation P17252 (PRKCA)
K105 Ubiquitination
S118 Phosphorylation P17252 (PRKCA) , P24941 (CDK2)
T120 Phosphorylation
S128 Phosphorylation
S131 Phosphorylation P24941 (CDK2)
S132 Phosphorylation P24941 (CDK2)
T133 Phosphorylation P24941 (CDK2)
S134 Phosphorylation P24941 (CDK2)
S135 Phosphorylation P24941 (CDK2)
T143 Phosphorylation
S145 Phosphorylation
S147 Phosphorylation P24941 (CDK2)
T150 Phosphorylation P24941 (CDK2)
K152 Ubiquitination
K153 Ubiquitination
S159 Phosphorylation Q13464 (ROCK1) , P17252 (PRKCA) , P05771 (PRKCB) , P17612 (PRKACA) , Q16512 (PKN1)
K161 Methylation
S163 Phosphorylation P17252 (PRKCA) , Q16512 (PKN1) , P05771 (PRKCB)
K165 Ubiquitination
S167 Phosphorylation P17252 (PRKCA)
S170 Phosphorylation P17252 (PRKCA) , Q16512 (PKN1) , P05771 (PRKCB)
K172 Acetylation
K172 Methylation
K176 Ubiquitination
K248 Methylation
S252 Phosphorylation
S262 Phosphorylation
K267 Ubiquitination
S314 Phosphorylation

Research Backgrounds

Function:

MARCKS is the most prominent cellular substrate for protein kinase C. This protein binds calmodulin, actin, and synapsin. MARCKS is a filamentous (F) actin cross-linking protein.

PTMs:

Phosphorylation by PKC displaces MARCKS from the membrane. It also inhibits the F-actin cross-linking activity.

Subcellular Location:

Cytoplasm>Cytoskeleton. Membrane>Lipid-anchor.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the MARCKS family.

Research Fields

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.