Atg13 Antibody | Affinity Biosciences

1/3

Western blot analysis of extracts from Serum-starved EC304 cells, using Atg13 Antibody.

Western blot analysis of extracts from Rat testis, using Atg13 Antibody.

Western blot analysis of extracts from various samples, using Atg13 Antibody.

Product:	Atg13 Antibody
Catalog:	AF2619
Description:	Rabbit polyclonal antibody to Atg13
Application:	WB
Reactivity:	Human, Mouse, Rat
Prediction:	Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.:	72kDa; 57kD(Calculated).
Uniprot:	O75143
RRID:	AB_2846787

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

Atg13 Antibody detects endogenous levels of total Atg13.

RRID:

AB_2846787
Cite Format: Affinity Biosciences Cat# AF2619, RRID:AB_2846787.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

ATG13; ATG13 autophagy related 13 homolog (S. cerevisiae); ATG13_HUMAN; Autophagy related 13; Autophagy related protein 13; Autophagy-related protein 13; FLJ20698; KIAA0652; OTTHUMP00000233321; OTTHUMP00000233322; OTTHUMP00000233323; OTTHUMP00000233324; OTTHUMP00000233325; OTTHUMP00000233326;

Immunogens

Immunogen:

A synthesized peptide derived from human Atg13.

Uniprot:

O75143(ATG13_HUMAN) >>Visit HPA database.

Gene(ID):

ATG13(9776)

Sequence:

O75143 ATG13_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ

PTMs - O75143 As Substrate

O75143

Site	PTM Type	Enzyme	Source
M1	Acetylation		Uniprot
S7	Phosphorylation		Uniprot
T24	Phosphorylation		Uniprot
K56	Ubiquitination		Uniprot
S141	Phosphorylation		Uniprot
K143	Ubiquitination		Uniprot
T170	Phosphorylation		Uniprot
T204	Phosphorylation		Uniprot
T332	Phosphorylation		Uniprot
S334	Phosphorylation		Uniprot
S355	Phosphorylation	O75385 (ULK1)	Uniprot
S356	Phosphorylation		Uniprot
S361	Phosphorylation		Uniprot
S389	Phosphorylation		Uniprot
K504	Ubiquitination		Uniprot

Research Backgrounds

O75143_ATG13_HUMAN

Function:

Autophagy factor required for autophagosome formation and mitophagy. Target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex. Through its regulation of ULK1 activity, plays a role in the regulation of the kinase activity of mTORC1 and cell proliferation.

PTMs:

Phosphorylated by ULK1, ULK2 and mTOR. Phosphorylation status depends on nutrient-rich conditions; dephosphorylated during starvation or following treatment with rapamycin. ULK1-mediated phosphorylation of ATG13 at Ser-355 is required for efficient clearance of depolarized mitochondria.

Subcellular Location:

Cytoplasm>Cytosol. Preautophagosomal structure.
Note: Under starvation conditions, is localized to puncate structures primarily representing the isolation membrane; the isolation membrane sequesters a portion of the cytoplasm resulting in autophagosome formation.

Subunit Structure:

Part of a complex consisting of ATG13, ULK1 and RB1CC1. Interacts with ATG101. Interacts with ULK1 (via C-terminus). Interacts with ULK2 (via C-terminus). Interacts (via the LIR motif) with GABARAP, GABARAPL, GABARAPL2. Interacts (via the LIR motif) with MAP1LC3A, MAP1LC3B and MAP1LC3C. Interacts with TAB2 and TAB3. Interacts with C9orf72.

Family&Domains:

The LIR motif (LC3-interacting region) is required for the interaction with the ATG8 family proteins GABARAP, GABARAPL, GABARAPL2, and MAP1LC3A.

Belongs to the ATG13 family. Metazoan subfamily.

Research Fields

· Cellular Processes > Transport and catabolism > Autophagy - other. (View pathway)

· Cellular Processes > Transport and catabolism > Autophagy - animal. (View pathway)

· Organismal Systems > Aging > Longevity regulating pathway. (View pathway)

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Atg13 Antibody - #AF2619