Product: Phospho-FUNDC1 (Ser17) antibody
Catalog: AF0001
Source: Rabbit
Application: WB
Reactivity: Human
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 17kD; 17kD(Calculated).
Uniprot: Q8IVP5
RRID: AB_2846773

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(88%), Chicken(100%)
Clonality:
Polyclonal
Specificity:
Phospho-FUNDC1 (Ser17) antibody detects endogenous levels of FUNDC1 only when phosphorylated at Serine 17.
RRID:
AB_2846773
Cite Format: Affinity Biosciences Cat# AF0001, RRID:AB_2846773.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

FUN14 domain containing 1; FUN14 domain containing protein 1; FUN14 domain-containing protein 1; FUND1_HUMAN; fundc1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q8IVP5 FUND1_HUMAN:

Widely expressed.

Sequence:
MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Chicken
100
Rabbit
100
Dog
88
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q8IVP5 As Substrate

Site PTM Type Enzyme
Y11 Phosphorylation
S13 Phosphorylation
S17 Phosphorylation
Y18 Phosphorylation
S40 Phosphorylation
S41 Phosphorylation
K119 Ubiquitination

Research Backgrounds

Function:

Acts as an activator of hypoxia-induced mitophagy, an important mechanism for mitochondrial quality control.

PTMs:

Phosphorylation at Tyr-18 by SRC inhibits activation of mitophagy. Following hypoxia, dephosphorylated at Tyr-18, leading to interaction with MAP1 LC3 family proteins and triggering mitophagy.

Subcellular Location:

Mitochondrion outer membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed.

Subunit Structure:

Interacts (via YXXL motif) with MAP1 LC3 family proteins MAP1LC3A, MAP1LC3B and GABARAP.

Family&Domains:

The YXXL motif mediates the interaction with MAP1 LC3 family proteins MAP1LC3A, MAP1LC3B and GABARAP.

Belongs to the FUN14 family.

References

1). Wu Y et al. Molybdenum and Cadmium Co-induce Mitochondrial Quality Control Disorder via FUNDC1-Mediated Mitophagy in Sheep Kidney. Front Vet Sci 2022 Jan 28;9:842259. (PubMed: 35155662)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.