Phospho-FUNDC1 (Ser17) antibody - #AF0001
(11)
(6)
| Product: | Phospho-FUNDC1 (Ser17) antibody |
| Catalog: | AF0001 |
| Description: | Rabbit polyclonal antibody to Phospho-FUNDC1 (Ser17) |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 17KD; 17kD(Calculated). |
| Uniprot: | Q8IVP5 |
| RRID: | AB_2846773 |
Product Info
Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Reactivity:
Human
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(88%), Chicken(100%)
Clonality:
Polyclonal
Specificity:
Phospho-FUNDC1 (Ser17) antibody detects endogenous levels of FUNDC1 only when phosphorylated at Serine 17.
RRID:
AB_2846773
Cite Format: Affinity Biosciences Cat# AF0001, RRID:AB_2846773.
Cite Format: Affinity Biosciences Cat# AF0001, RRID:AB_2846773.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:
Fold/Unfold
FUN14 domain containing 1; FUN14 domain containing protein 1; FUN14 domain-containing protein 1; FUND1_HUMAN; fundc1;
Immunogens
Immunogen:
Uniprot:
Gene(ID):
Expression:
Sequence:
- Q8IVP5 FUND1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS
Predictions
Predictions:
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Chicken
100
Rabbit
100
Dog
88
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8IVP5 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y11 | Phosphorylation | Uniprot | |
| S13 | Phosphorylation | Uniprot | |
| S17 | Phosphorylation | Uniprot | |
| Y18 | Phosphorylation | Uniprot | |
| S40 | Phosphorylation | Uniprot | |
| S41 | Phosphorylation | Uniprot | |
| K119 | Ubiquitination | Uniprot |
Research Backgrounds
Function:
Acts as an activator of hypoxia-induced mitophagy, an important mechanism for mitochondrial quality control.
PTMs:
Phosphorylation at Tyr-18 by SRC inhibits activation of mitophagy. Following hypoxia, dephosphorylated at Tyr-18, leading to interaction with MAP1 LC3 family proteins and triggering mitophagy.
Subcellular Location:
Mitochondrion outer membrane>Multi-pass membrane protein.
Tissue Specificity:
Widely expressed.
Subunit Structure:
Interacts (via YXXL motif) with MAP1 LC3 family proteins MAP1LC3A, MAP1LC3B and GABARAP.
Family&Domains:
The YXXL motif mediates the interaction with MAP1 LC3 family proteins MAP1LC3A, MAP1LC3B and GABARAP.
Belongs to the FUN14 family.
References
1). DDX21 mediates co-transcriptional RNA m6A modification to promote transcription termination and genome stability. Molecular cell, 2024
(PubMed: 38569554)
[IF=16.0]
2). Pharmacological inhibition of Septins with Forchlorfenuron attenuates thrombus formation in experimental thrombotic mice models with modulating multiple signaling pathways in platelets. Journal of advanced research, 2024
(PubMed: 39111626)
[IF=10.7]
3). FUNDC1-mediated mitophagy triggered by mitochondrial ROS is partially involved in 1-nitropyrene-evoked placental progesterone synthesis inhibition and intrauterine growth retardation in mice. The Science of the total environment, 2024
(PubMed: 37951264)
[IF=9.8]
4). TBK1 Facilitates GLUT1-Dependent Glucose Consumption by suppressing mTORC1 Signaling in Colorectal Cancer Progression. International Journal of Biological Sciences, 2023
(PubMed: 35637944)
[IF=9.2]
5). NTRK1 knockdown induces mouse cognitive impairment and hippocampal neuronal damage through mitophagy suppression via inactivating the AMPK/ULK1/FUNDC1 pathway. Cell death discovery, 2023
(PubMed: 37907480)
[IF=7.0]
Application: WB Species: Mouse Sample:
Fig. 6 NTRK1 silencing might suppress mitophagy in mouse neurons through the inactivation of the AMPK/ULK1/FUNDC1 pathway. A, B WB revealed that O304 treatment abrogated the suppression effect of NTRK1 knockdown on the activity of the AMPK/ULK1/FUNDC1 pathway in mouse neurons. n = 3. C, D WB also indicated that O304 treatment counteracted the suppression effect of NTRK1 silencing on mitophagy in mouse neurons. n = 3. E, F The results of TOMM20/LC3-II fluorescence staining revealed that the O304 treatment reversed the suppression effect of NTRK1 knockdown on the expression of Parkin in mouse neuronmitochondria. n = 3.
6). Hypoxia‑induced mitophagy regulates proliferation, migration and odontoblastic differentiation of human dental pulp cells through FUN14 domain‑containing 1. International Journal of Molecular Medicine, 2022
(PubMed: 35362539)
[IF=5.4]
Application: IHC Species: Human Sample: HDPCs
Figure 1
Expressions of inflammatory cytokines, HIF-1α and FUNDC1 in healthy and pulpitis tissues. (A) mRNA expression of IL-1β, IL-6, IL-8 and TNF-α in human healthy and pulpitis tissues. mRNA expression of (B) HIF-1α and (C) FUNDC1 in human healthy and pulpitis tissues. (D) Representative immunostaining images of HIF-1α and FUNDC1 in human healthy or inflamed dental pulp tissues. Scale bars are 100 and 25 µm, respectively. Results are presented as the means ± SD from ≥ three independent experiments. *P<0.05, **P<0.01 and ***P<0.001 vs. healthy. HIF-1α, hypoxia-inducible factor-1α; FUNDC1, FUN14 domain-containing 1.
7). LAMP2A regulates the balance of mesenchymal stem cell adipo-osteogenesis via the Wnt/β-catenin/GSK3β signaling pathway. Journal of Molecular Medicine, 2023
(PubMed: 37162558)
[IF=4.7]
8). PRKAA2-mediated mitophagy regulates oxygen consumption in yak renal tubular epithelial cells under chronic hypoxia. CELLULAR SIGNALLING, 2024
[IF=4.4]
9). Human umbilical cord-derived mesenchymal stem cells (hUC-MSCs) alleviate excessive autophagy of ovarian granular cells through VEGFA/PI3K/AKT/mTOR pathway in premature ovarian failure rat model. Journal of Ovarian Research, 2023
(PubMed: 37777781)
[IF=4.0]
Application: WB Species: Rat Sample:
Fig. 2 hUC-MSC improved the ovarian function of POF rats. A The percentage of each stage in the estrus cycle (the asterisk indicates there are significances in that group by comparing to the other two groups). The serum AMH (B), E2 (C), FSH (D), and LH (E) levels. F Ki67 expression in ovarian GCs; scale bar: 100 μm. G The Western blotting images and quantitation of functional protein expression in GCs. H The fertility and litter size.
10). Molybdenum and Cadmium Co-induce Mitochondrial Quality Control Disorder via FUNDC1-Mediated Mitophagy in Sheep Kidney. Frontiers in Veterinary Science, 2022
(PubMed: 35155662)
[IF=3.2]
Application: WB Species: Sheep Sample: kidney tissue
Figure 6
Effects of Mo and/or Cd on immunofluorescence of LC3, mitophagy-related mRNA and protein expression levels. (A) The mRNA levels of FUNDC1, LC3A, LC3B and PGAM5. (B) The western blot results of FUNDC1, p-FUNDC1 and LC3. (C) The quantification of FUNDC1, p-FUNDC1 (Ser17) and LC3II/LC3I protein levels. (D) Immunofluorescence co-location of COX IV and LC3 at day 50. In the images, the nucleus staining is shown in blue, COX IV staining is shown in green, LC3 staining is shown in red, and the signals of colocalization are shown in merged images. (E) Pearson coefficient of the colocalization of COX IV and LC3. Data are expressed as means ± SD (n = 6). “*” indicates significant difference compared to the corresponding control (*P < 0.05, **P < 0.01). “#” indicates statistically significant difference between corresponding groups (#P < 0.05, ##P < 0.01).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.