Product: Phospho-MLC2 (Ser15) Antibody
Catalog: AF8618
Source: Rabbit
Application: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 18kD; 19kD(Calculated).
Uniprot: P10916
RRID: AB_2846214

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:200-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
Reactivity:
Human,Mouse,Rat
Prediction:
Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%)
Clonality:
Polyclonal
Specificity:
Phospho-MLC2 (Ser15) Antibody detects endogenous levels of MLC2 only when phosphorylated at Ser15.
RRID:
AB_2846214
Cite Format: Affinity Biosciences Cat# AF8618, RRID:AB_2846214.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Cardiac myosin light chain-2;Cardiac ventricular myosin light chain 2;CMH10;MLC 2v;MLC-2;MLC-2v;MLC2;MLRV_HUMAN;MYL 2;MYL2;Myosin light chain 2 regulatory cardiac slow;Myosin light polypeptide 2 regulatory cardiac slow;Myosin regulatory light chain 2;Myosin regulatory light chain 2 ventricular/cardiac muscle isoform;Regulatory light chain of myosin;RLC of myosin;Slow cardiac myosin regulatory light chain 2;ventricular/cardiac muscle isoform;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Sheep
100
Dog
100
Chicken
100
Rabbit
100
Xenopus
75
Pig
0
Bovine
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P10916 As Substrate

Site PTM Type Enzyme
S15 Phosphorylation Q15746 (MYLK)
S19 Phosphorylation Q5VT25 (CDC42BPA)
T80 Phosphorylation
T98 Phosphorylation
K104 Acetylation
K111 Acetylation
Y118 Phosphorylation
T124 Phosphorylation
Y152 Phosphorylation
K153 Acetylation
K165 Acetylation

Research Backgrounds

Function:

Contractile protein that plays a role in heart development and function (By similarity). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (By similarity). During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly (By similarity).

PTMs:

N-terminus is methylated by METTL11A/NTM1.

Phosphorylated by MYLK3 and MYLK2; promotes cardiac muscle contraction and function (By similarity). Dephosphorylated by PPP1CB complexed to PPP1R12B (By similarity). The phosphorylated form in adult is expressed as gradients across the heart from endocardium (low phosphorylation) to epicardium (high phosphorylation); regulates cardiac torsion and workload distribution (By similarity).

Subcellular Location:

Cytoplasm>Myofibril>Sarcomere>A band.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Myosin is a hexamer of 2 heavy chains and 4 light chains. Interacts with MYOC.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Tight junction.   (View pathway)

· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.   (View pathway)

· Environmental Information Processing > Signal transduction > Apelin signaling pathway.   (View pathway)

· Human Diseases > Cardiovascular diseases > Hypertrophic cardiomyopathy (HCM).

· Human Diseases > Cardiovascular diseases > Dilated cardiomyopathy (DCM).

· Organismal Systems > Circulatory system > Cardiac muscle contraction.   (View pathway)

· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.   (View pathway)

· Organismal Systems > Immune system > Leukocyte transendothelial migration.   (View pathway)

References

1). Chong S et al. Echinococcus multilocularis drives the polarization of macrophages by regulating the RhoA-MAPK signaling pathway and thus affects liver fibrosis. Bioengineered 2022 Apr;13(4):8747-8758. (PubMed: 35324411) [IF=6.832]

2). Liu Y et al. β-patchoulene simultaneously ameliorated dextran sulfate sodium-induced colitis and secondary liver injury in mice via suppressing colonic leakage and flora imbalance. Biochem Pharmacol 2020 Oct 2;114260. (PubMed: 33017576) [IF=6.100]

Application: WB    Species: mouse    Sample: colon

Fig.4.| Effect of β-PAE on TLR4/MyD88/NF-κB and ROCK/MLC signalling pathway.(A) Representative bands of TLR4, MyD88, phospho-IκBα, IκBα and p65. (B)Quantitative results of band densities of TLR4, MyD88, phospho-IκBα, IκBα and p65.(C) Representative bands of ROCK1, phospho-MLC2 and MLC2.

3). Zhu YC et al. Inhibition of Peripheral ERK Signaling Ameliorates Persistent Muscle Pain Around Trigger Points in Rats. Cell Transplant Jan-Dec 2020;29:963689720960190. (PubMed: 33081508) [IF=4.139]

Application: WB    Species: rat    Sample: muscle

Figure 6. |MLCK might be the target of the ERK inhibitor involved in ameliorating muscular mechanical hyperalgesia. (C) The expression of p-MLC protein. p-MLC expression was increased in the MPS group compared with that in the control group. p-MLC expression was decreased in the ERK inhibitor group compared with that in the MPS group.

4). Yang M et al. RHOA inhibits chondrogenic differentiation of mesenchymal stem cells in adolescent idiopathic scoliosis. Connect Tissue Res 2022 Jan 12;1-10. (PubMed: 35019797) [IF=3.342]

5). Zheng X et al. Brusatol-Enriched Brucea javanica Oil Ameliorated Dextran Sulfate Sodium-Induced Colitis in Mice: Involvement of NF-κB and RhoA/ROCK Signaling Pathways. Biomed Res Int 2021 Aug 9;2021:5561221. (PubMed: 34414236) [IF=3.246]

Application: WB    Species: Mice    Sample: colon tissue

Figure 7 BE-BJO inhibited the activation of the RhoA/ROCK signaling pathway in DSS-induced UC in mice. Representative Western Blot images of GTP RhoA, total RhoA, ROCK-1, p-MLC, and MLC (a). The relative protein expressions of GTP RhoA (b), ROCK-1 (c), and p-MLC (d) in colon tissue were detected by Western Blot. All values are presented as the mean ± SEM. ##P < 0.01 versus normal group; ∗P < 0.05, ∗∗P < 0.01, and ∗∗∗P < 0.001 versus DSS group.

6). Calycosin-7-O-β-D-Glucoside Treatment Promotes Axonal Regeneration via Rho/ROCK Pathway After Ischemia/Reperfusion Injury.

7). Li Y et al. Polydopamine-mediated graphene oxide and nanohydroxyapatite-incorporated conductive scaffold with an immunomodulatory ability accelerates periodontal bone regeneration in diabetes. Bioact Mater 2022 Mar 22;18:213-227. (PubMed: 35387166)

8). Chen B et al. Protective effect of oxyberberine against acute lung injury in mice via inhibiting RhoA/ROCK signaling pathway. Biomed Pharmacother 2022 Jun 23;153:113307. (PubMed: 35753262)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.