Price Size
$250 50ul
$350 100ul
$450 200ul

Same day delivery

Contact distributor
  • Product Name
    Cytochrome C antibody
  • Catalog No.
    BF0714
  • RRID
    AB_2846192
  • Source
    Mouse
  • Application
    WB,IHC
  • Reactivity
    Human, Mouse, Rat, Rabbit
  • UniProt
  • Mol.Wt
    11kD;
    12kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Product Information

Alternative Names:Expand▼

CYC; CYC_HUMAN; CYCS; Cytochrome c; Cytochrome c somatic; HCS; THC4;

Applications:

WB(1:500-1:2000), IHC(1:100-1:1000)
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat, Rabbit

Source:

Mouse

Clonality:

Monoclonal

Clone Number:

AFB17778

Purification:

Affinity-chromatography.

Specificity:

Cytochrome C antibody detects endogenous levels of total Cytochrome C.

RRID:

AB_2846192
Please cite this product as: Affinity Biosciences Cat# BF0714, RRID:AB_2846192.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

Purified recombinant fragment of human Cytochrome C expressed in E. Coli.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

CYCS

Molecular Weight:

Observed Mol.Wt.: 11kD.
Predicted Mol.Wt.: 12kDa(Calculated)..

Sequence:
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Research Background

Function:

Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.

Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases.

Post-translational Modifications:

Binds 1 heme group per subunit.

Phosphorylation at Tyr-49 and Tyr-98 both reduce by half the turnover in the reaction with cytochrome c oxidase, down-regulating mitochondrial respiration.

Subcellular Location:

Mitochondrion intermembrane space.
Note: Loosely associated with the inner membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Similarity:

Belongs to the cytochrome c family.

Research Fields

Research Fields:

· Cellular Processes > Cell growth and death > p53 signaling pathway.(View pathway)
· Cellular Processes > Cell growth and death > Apoptosis.(View pathway)
· Cellular Processes > Cell growth and death > Apoptosis - multiple species.(View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Colorectal cancer.(View pathway)
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
· Human Diseases > Cardiovascular diseases > Viral myocarditis.
· Human Diseases > Infectious diseases: Bacterial > Legionellosis.
· Human Diseases > Cancers: Specific types > Small cell lung cancer.(View pathway)
· Human Diseases > Neurodegenerative diseases > Amyotrophic lateral sclerosis (ALS).
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
· Metabolism > Energy metabolism > Sulfur metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

BF0714-BP
(Blocking peptide available as BF0714-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

P99999 as Substrate
Site PTM Type Enzyme
G2 Acetylation
K9 Acetylation
K28 Sumoylation
K28 Ubiquitination
T29 Phosphorylation
K40 Ubiquitination
T41 Phosphorylation
Y47 Phosphorylation
S48 Phosphorylation
Y49 Phosphorylation
T50 Phosphorylation
K54 Ubiquitination
Y68 Phosphorylation
K73 Acetylation
K73 Ubiquitination
K74 Acetylation
K74 Ubiquitination
Y75 Phosphorylation
T79 Phosphorylation
K80 Ubiquitination
K87 Acetylation
K87 Ubiquitination
K88 Acetylation
K89 Acetylation
Y98 Phosphorylation
K100 Acetylation
K100 Methylation
K100 Ubiquitination
K101 Methylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top