GCHFR Antibody - #DF13035
Product: | GCHFR Antibody |
Catalog: | DF13035 |
Description: | Rabbit polyclonal antibody to GCHFR |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 10 kDa; 10kD(Calculated). |
Uniprot: | P30047 |
RRID: | AB_2845996 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13035, RRID:AB_2845996.
Fold/Unfold
GCHFR; GFRP; GFRP_HUMAN; GTP cyclohydrolase 1 feedback regulatory protein; GTP cyclohydrolase I feedback regulator; GTP cyclohydrolase I feedback regulatory protein; HsT16933; MGC138467; MGC138469; p35;
Immunogens
In epidermis, expressed predominantly in basal undifferentiated keratinocytes and in some but not all melanocytes (at protein level).
- P30047 GFRP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P30047 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K36 | Acetylation | Uniprot | |
Y45 | Phosphorylation | Uniprot | |
Y47 | Phosphorylation | Uniprot | |
Y48 | Phosphorylation | Uniprot | |
K59 | Ubiquitination | Uniprot |
Research Backgrounds
Mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase 1. This inhibition is reversed by L-phenylalanine.
Nucleus. Nucleus membrane. Cytoplasm>Cytosol.
In epidermis, expressed predominantly in basal undifferentiated keratinocytes and in some but not all melanocytes (at protein level).
Homopentamer. Forms a complex with GCH1 where a GCH1 homodecamer is sandwiched by two GFRP homopentamers (By similarity). Interacts with GCH1.
Belongs to the GFRP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.