Price Size
$280 100ul
$350 200ul

Same day delivery

Contact distributor
  • Product Name
    RASH/RASK/RASN Antibody
  • Catalog No.
    AF0247
  • RRID
    AB_2833422
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
  • UniProt
  • Mol.Wt
    25kD,21kD;
    21kDa,21kDa,22kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

ALPS4; AV095280; GTPase NRas; HRAS1; N ras; N ras protein part 4; Neuroblastoma RAS viral (v ras) oncogene homolog; NRAS; NRAS1; NS6; OTTHUMP00000013879; OTTMUSP00000023521; RASN_HUMAN; Transforming protein N Ras; Transforming protein N-Ras; v ras neuroblastoma RAS viral oncogene homolog; C BAS/HAS; c H ras; C HA RAS1; c has/bas p21 protein; c ras Ki 2 activated oncogene; c-H-ras; CTLO; GTP and GDP binding peptide B; GTPase HRas, N-terminally processed; H Ras 1; H RASIDX; H-Ras-1; Ha Ras; Ha Ras1 proto oncoprotein; Ha-Ras; HAMSV; Harvey rat sarcoma viral oncogene homolog; Harvey rat sarcoma viral oncoprotein; HRAS; HRAS1; K ras; N ras; p19 H RasIDX protein; p21ras; Ras family small GTP binding protein H Ras; RASH_HUMAN; RASH1; Transformation gene oncogene HAMSV; Transforming protein p21; v Ha ras Harvey rat sarcoma viral oncogene homolog; VH Ras; vHa RAS; c Ki ras2; c Kirsten ras protein; c-K-ras; c-Ki-ras; Cellular c Ki ras2 proto oncogene; Cellular transforming proto oncogene; CFC2; cK Ras; GTPase KRas; K RAS p21 protein; K RAS2A; K RAS2B; K RAS4A; K RAS4B; K-Ras 2; KI RAS; Ki-Ras; KIRSTEN MURINE SARCOMA VIRUS 2; Kirsten rat sarcoma 2 viral (v Ki ras2) oncogene homolog; Kirsten rat sarcoma viral oncogene homolog; KRAS; KRAS proto oncogene, GTPase; KRAS1; KRAS2; N-terminally processed; NS; NS3; Oncogene KRAS2; p21ras; PR310 c K ras oncogene; PR310 cK ras oncogene; RALD; RASK_HUMAN; RASK2; Transforming protein p21; v Ki ras2 Kirsten rat sarcoma 2 viral oncogene homolog; v Ki ras2 Kirsten rat sarcoma viral oncogene homolog;

Applications:

WB: 1:500-1:3000, IHC: 1:50-1:200, IF/ICC 1:100-300, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

RASH/RASK/RASN Antibody detects endogenous levels of total RASH/RASK/RASN.

RRID:

AB_2833422
Please cite this product as: Affinity Biosciences Cat# AF0247, RRID:AB_2833422.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

A synthesized peptide derived from human RASH/RASK/RASN, corresponding to a region within N-terminal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

NRAS,HRAS,KRAS

Molecular Weight:

Observed Mol.Wt.: 25kD,21kD.
Predicted Mol.Wt.: 21kDa,21kDa,22kDa(Calculated)..

Subcellular Location:

Cell Membrane, Cytoplasmic and Golgi Apparatus

Tissue Specificity:

P01112 RASH_HUMAN:
Widely expressed.

Description:

HRas a small GTPase protein of the Ras family. Alternates between an inactive form bound to GDP and an active form bound to GTP. Activated by a guanine nucleotide-exchange factor (GEF) and inactivated by a GTPase-activating protein (GAP). Mutations are implicated in a variety of human tumors.

Sequence:
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM

Research Background

Function:

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.

Post-translational Modifications:

Palmitoylated by the ZDHHC9-GOLGA7 complex (PubMed:16000296). Depalmitoylated by ABHD17A, ABHD17B and ABHD17C (PubMed:26701913). A continuous cycle of de- and re-palmitoylation regulates rapid exchange between plasma membrane and Golgi (PubMed:16000296, PubMed:15705808, PubMed:2661017, PubMed:26701913).

Acetylation at Lys-104 prevents interaction with guanine nucleotide exchange factors (GEFs).

Ubiquitinated by the BCR(LZTR1) E3 ubiquitin ligase complex at Lys-170 in a non-degradative manner, leading to inhibit Ras signaling by decreasing Ras association with membranes.

Phosphorylation at Ser-89 by STK19 enhances NRAS-association with its downstream effectors.

Subcellular Location:

Cell membrane>Lipid-anchor>Cytoplasmic side. Golgi apparatus membrane>Lipid-anchor.
Note: Shuttles between the plasma membrane and the Golgi apparatus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Subunit Structure:

Interacts (active GTP-bound form preferentially) with RGS14 (By similarity). Interacts (active GTP-bound form) with RASSF7 (PubMed:21278800).

Similarity:

Belongs to the small GTPase superfamily. Ras family.

Function:

Involved in the activation of Ras protein signal transduction (PubMed:22821884). Ras proteins bind GDP/GTP and possess intrinsic GTPase activity (PubMed:12740440, PubMed:14500341, PubMed:9020151).

Post-translational Modifications:

Palmitoylated by the ZDHHC9-GOLGA7 complex. A continuous cycle of de- and re-palmitoylation regulates rapid exchange between plasma membrane and Golgi.

S-nitrosylated; critical for redox regulation. Important for stimulating guanine nucleotide exchange. No structural perturbation on nitrosylation.

The covalent modification of cysteine by 15-deoxy-Delta12,14-prostaglandin-J2 is autocatalytic and reversible. It may occur as an alternative to other cysteine modifications, such as S-nitrosylation and S-palmitoylation.

Acetylation at Lys-104 prevents interaction with guanine nucleotide exchange factors (GEFs).

Ubiquitinated by the BCR(LZTR1) E3 ubiquitin ligase complex at Lys-170 in a non-degradative manner, leading to inhibit Ras signaling by decreasing Ras association with membranes.

Subcellular Location:

Cell membrane>Lipid-anchor>Cytoplasmic side. Golgi apparatus. Golgi apparatus membrane>Lipid-anchor.
Note: The active GTP-bound form is localized most strongly to membranes than the inactive GDP-bound form (By similarity). Shuttles between the plasma membrane and the Golgi apparatus.

Nucleus. Cytoplasm. Cytoplasm>Perinuclear region.
Note: Colocalizes with RACK1 to the perinuclear region.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Widely expressed.

Subunit Structure:

In its GTP-bound form interacts with PLCE1 (PubMed:11022048). Interacts with TBC1D10C (PubMed:17230191). Interacts with RGL3 (By similarity). Interacts with HSPD1 (By similarity). Found in a complex with at least BRAF, HRAS, MAP2K1, MAPK3 and RGS14 (By similarity). Interacts (active GTP-bound form) with RGS14 (via RBD 1 domain) (By similarity). Forms a signaling complex with RASGRP1 and DGKZ (PubMed:11257115). Interacts with RASSF5 (PubMed:18596699). Interacts with PDE6D (PubMed:11980706). Interacts with IKZF3 (PubMed:10369681). Interacts with RACK1 (PubMed:14500341). Interacts with PIK3CG; the interaction is required for membrane recruitment and beta-gamma G protein dimer-dependent activation of the PI3K gamma complex PIK3CG:PIK3R6 (By similarity). Interacts with RAPGEF2 (PubMed:10608844, PubMed:11598133).

Similarity:

Belongs to the small GTPase superfamily. Ras family.

Function:

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation (PubMed:23698361, PubMed:22711838). Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner (PubMed:24623306).

Post-translational Modifications:

Acetylation at Lys-104 prevents interaction with guanine nucleotide exchange factors (GEFs).

Ubiquitinated by the BCR(LZTR1) E3 ubiquitin ligase complex at Lys-170 in a non-degradative manner, leading to inhibit Ras signaling by decreasing Ras association with membranes.

Subcellular Location:

Cell membrane>Lipid-anchor>Cytoplasmic side. Cytoplasm>Cytosol.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Subunit Structure:

Interacts with PHLPP. Interacts (active GTP-bound form preferentially) with RGS14 (By similarity). Interacts (when farnesylated) with PDE6D; this promotes dissociation from the cell membrane (PubMed:23698361). Interacts with SOS1 (PubMed:22431598).

Similarity:

Belongs to the small GTPase superfamily. Ras family.

Research Fields

Research Fields:

· Cellular Processes > Cellular community - eukaryotes > Gap junction.(View pathway)
· Cellular Processes > Cell growth and death > Apoptosis.(View pathway)
· Cellular Processes > Transport and catabolism > Autophagy - animal.(View pathway)
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells.(View pathway)
· Cellular Processes > Cell growth and death > Cellular senescence.(View pathway)
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.(View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > ErbB signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > mTOR signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Apelin signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.(View pathway)
· Human Diseases > Cancers: Specific types > Renal cell carcinoma.(View pathway)
· Human Diseases > Cancers: Specific types > Thyroid cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Bladder cancer.(View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Gastric cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Non-small cell lung cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Glioma.(View pathway)
· Human Diseases > Cancers: Specific types > Colorectal cancer.(View pathway)
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.(View pathway)
· Human Diseases > Cancers: Specific types > Acute myeloid leukemia.(View pathway)
· Human Diseases > Cancers: Overview > MicroRNAs in cancer.
· Human Diseases > Cancers: Specific types > Endometrial cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Breast cancer.(View pathway)
· Human Diseases > Cancers: Specific types > Chronic myeloid leukemia.(View pathway)
· Human Diseases > Cancers: Overview > Central carbon metabolism in cancer.(View pathway)
· Human Diseases > Cancers: Overview > Choline metabolism in cancer.(View pathway)
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Human Diseases > Infectious diseases: Viral > Hepatitis B.
· Human Diseases > Cancers: Specific types > Melanoma.(View pathway)
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Human Diseases > Drug resistance: Antineoplastic > EGFR tyrosine kinase inhibitor resistance.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Substance dependence > Alcoholism.
· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.
· Human Diseases > Cancers: Specific types > Prostate cancer.(View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway.(View pathway)
· Organismal Systems > Immune system > Fc epsilon RI signaling pathway.(View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.(View pathway)
· Organismal Systems > Endocrine system > Relaxin signaling pathway.
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Insulin signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Prolactin signaling pathway.(View pathway)
· Organismal Systems > Nervous system > Long-term potentiation.
· Organismal Systems > Nervous system > Neurotrophin signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Oxytocin signaling pathway.
· Organismal Systems > Development > Axon guidance.(View pathway)
· Organismal Systems > Nervous system > Long-term depression.
· Organismal Systems > Aging > Longevity regulating pathway.(View pathway)
· Organismal Systems > Nervous system > Cholinergic synapse.
· Organismal Systems > Aging > Longevity regulating pathway - multiple species.(View pathway)
· Organismal Systems > Endocrine system > Melanogenesis.
· Organismal Systems > Immune system > Chemokine signaling pathway.(View pathway)
· Organismal Systems > Nervous system > Serotonergic synapse.
· Organismal Systems > Immune system > B cell receptor signaling pathway.(View pathway)
· Organismal Systems > Endocrine system > Estrogen signaling pathway.(View pathway)

Reference Citations:

1). Li MY et al. Anti-Inflammatory Effects of Huangqin Decoction on Dextran Sulfate Sodium-Induced Ulcerative Colitis in Mice Through Regulation of the Gut Microbiota and Suppression of the Ras-PI3K-Akt-HIF-1α and NF-κB Pathways. Front Pharmacol 2020 Jan 20;10:1552 (PubMed: 32038240) [IF=4.225]

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF0247-BP
(Blocking peptide available as AF0247-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Zebrafish
100%
Chicken
100%
Rabbit
100%
Xenopus
100%
Dog
100%
Horse
100%
Bovine
100%
Sheep
100%
Pig
100%
High similarity Medium similarity Low similarity No similarity
P01111/P01112/P01116 as Substrate
Site PTM Type Enzyme
Y32 Phosphorylation P12931 (SRC)
S39 Phosphorylation
Y40 Phosphorylation
Y64 Phosphorylation
C80 S-Nitrosylation
K88 Methylation
S89 Phosphorylation
K117 Ubiquitination
C118 S-Nitrosylation
K128 Ubiquitination
K135 Ubiquitination
Y137 Phosphorylation
K147 Ubiquitination
T148 Phosphorylation
Y157 Phosphorylation
T158 Phosphorylation
K170 Ubiquitination
Site PTM Type Enzyme
Y32 Phosphorylation P12931 (SRC)
T35 Phosphorylation
S39 Phosphorylation
Y40 Phosphorylation
Y64 Phosphorylation P12931 (SRC)
C80 S-Nitrosylation
Y96 Phosphorylation P12931 (SRC)
K117 Ubiquitination
C118 S-Nitrosylation
Y137 Phosphorylation P00519 (ABL1) , P42684 (ABL2)
T144 Phosphorylation P49841 (GSK3B)
S145 Phosphorylation
K147 Ubiquitination
T148 Phosphorylation P49841 (GSK3B)
Y157 Phosphorylation
T158 Phosphorylation
K170 Ubiquitination
C181 S-Nitrosylation
S183 Phosphorylation
Site PTM Type Enzyme
T2 Phosphorylation
Y4 Phosphorylation
Y32 Phosphorylation
S39 Phosphorylation
Y40 Phosphorylation
Y64 Phosphorylation
S89 Phosphorylation
Y96 Phosphorylation
K101 Acetylation
K104 Acetylation
K104 Ubiquitination
S106 Phosphorylation
K117 Ubiquitination
K128 Acetylation
K128 Ubiquitination
Y137 Phosphorylation
T144 Phosphorylation
K147 Acetylation
K147 Ubiquitination
T148 Phosphorylation
Y157 Phosphorylation
K170 Ubiquitination
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top