Cleaved-IL-1 beta (Asp116) Antibody

$FIGURE 2 Icariin inhibited the secretion of pro-inflammatory cytokine IL-1β in 5/6 (A/I) rats. (A) The location between CD68 and α-SMA proteins was analyzed by IF double staining. 200 magnification (B) The protein content of NF-κB in cytosolic and nuclear fractions was detected by immunoblotting. GAPDH and Lamin B1 were used as loading controls. (C) Quantitative analysis of NF-κB protein content in cytoplasm and nucleus. (D) Representative immunoblot demonstrating the content of cleaved IL-1β protein. (E) Quantification of cleaved IL-1β level. (F) The concentration of IL-1β in circulation was detected by ELISA method. (G) The serum levels of total antioxidant capacity were measured by the ABTS method. (H) Determination of Mn-SOD activity in kidney tissues by the WST-8 method. (I) Determination of MDA content in kidney tissues by the TBA method. n = 3–6 per group. Data were analyzed by One-way ANOVA with LSD post hoc tests. Values are mean ± SD. **p < 0.01, ***p < 0.001 versus Sham, # p < 0.05, ##p < 0.01, ###p < 0.001 vs. 5/6(A/I). Sham, Sham group; Sham + ICAH, Sham + Icariin high-dose group; 5/6 (A/I), 5/6 (A/I) group; 5/6 (A/I) + ICAL, 5/6 (A/I) + Icariin low-dose group; 5/6 (A/I) + ICAH, 5/6 (A/I) + Icariin high-dose group [Colour figure can be viewed at wileyonlinelibrary.com]$

FIGURE 2 Icariin inhibited the secretion of pro-inflammatory cytokine IL-1β in 5/6 (A/I) rats.

FIGURE 4 The effects of AICAR on the activation of the AMPK/Nrf2 signaling pathway and inhibition of NLRP3 inflammasome activation in the liver tissues of sodium taurocholate-induced SAP rats.

Fig.

FIGURE 5 Effects of TDZD‐8 on spinal NLRP3 inflammasome cascade.

Figure 4.

Figure 1.

Figure 3 DMB inhibited TLR4 signaling in a MyD88-dependent and -independent manner.

1：假手术组；2：ICH组；3：ICH+DMSO+PEG400组；4：ICH+NGN中剂量组A：Western blot检测大鼠ICH后PKC-δ、Phospho PKC-δ、NF-κB、IL-1β、IL-6的表达；B：PKC-δ的相对磷酸化水平；C~E：分别为NF-κB、IL-1β、IL-6的相对表达水平a：P < 0.

Fig.

Product:	Cleaved-IL-1 beta (Asp116) Antibody
Catalog:	AF4006
Description:	Rabbit polyclonal antibody to Cleaved-IL-1 beta (Asp116)
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat, Zebrafish
Mol.Wt.:	17 kDa; 31kD(Calculated).
Uniprot:	P01584
RRID:	AB_2801567

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
50ul	$250	In stock
100ul	$350	In stock
200ul	$450	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat,Zebrafish

Clonality:

Polyclonal

Specificity:

Cleaved-IL-1 beta (Asp116) Antibody detects endogenous levels of fragment of activated IL-1 beta resulting from cleavage adjacent to Asp116.

RRID:

AB_2801567
Cite Format: Affinity Biosciences Cat# AF4006, RRID:AB_2801567.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Catabolin; H1; IL 1; IL 1 beta; IL-1 beta; IL1 BETA; IL1B; IL1B_HUMAN; IL1F2; Interleukin 1 beta; Interleukin-1 beta; OAF; OTTHUMP00000162031; Preinterleukin 1 beta; Pro interleukin 1 beta;

Immunogens

Immunogen:

Uniprot:

P01584(IL1B_HUMAN) >>Visit HPA database.

Gene(ID):

IL1B(3553)

Expression:

P01584 IL1B_HUMAN:

Expressed in activated monocytes/macrophages (at protein level).

Sequence:

P01584 IL1B_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

PTMs - P01584 As Substrate

P01584

Site	PTM Type	Source
Y140	Phosphorylation	Uniprot
S200	Phosphorylation	Uniprot
S269	Phosphorylation	Uniprot

Research Backgrounds

P01584_IL1B_HUMAN

Function:

Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells.

PTMs:

Activation of the IL1B precursor involves a CASP1-catalyzed proteolytic cleavage. Processing and secretion are temporarily associated.

Subcellular Location:

Cytoplasm>Cytosol. Lysosome. Secreted>Extracellular exosome. Secreted.
Note: The precursor is cytosolic. In response to inflammasome-activating signals, such as ATP for NLRP3 inflammasome or bacterial flagellin for NLRC4 inflammasome, cleaved and secreted. IL1B lacks any known signal sequence and the pathway(s) of its secretion is(are) not yet fully understood (PubMed:24201029). On the basis of experimental results, several unconventional secretion mechanisms have been proposed. 1. Secretion via secretory lysosomes: a fraction of CASP1 and IL1B precursor may be incorporated, by a yet undefined mechanism, into secretory lysosomes that undergo Ca(2+)-dependent exocytosis with release of mature IL1B (PubMed:15192144). 2. Secretory autophagy: IL1B-containing autophagosomes may fuse with endosomes or multivesicular bodies (MVBs) and then merge with the plasma membrane releasing soluble IL1B or IL1B-containing exosomes (PubMed:24201029). However, autophagy impacts IL1B production at several levels and its role in secretion is still controversial. 3. Secretion via exosomes: ATP-activation of P2RX7 leads to the formation of MVBs containing exosomes with entrapped IL1B, CASP1 and other inflammasome components. These MVBs undergo exocytosis with the release of exosomes. The release of soluble IL1B occurs after the lysis of exosome membranes (By similarity). 4. Secretion by microvesicle shedding: activation of the ATP receptor P2RX7 may induce an immediate shedding of membrane-derived microvesicles containing IL1B and possibly inflammasome components. The cytokine is then released in the extracellular compartment after microvesicle lysis (PubMed:11728343). 5. Release by translocation through permeabilized plasma membrane. This may occur in cells undergoing pyroptosis due to sustained activation of the inflammasome (By similarity). These mechanisms may not be not mutually exclusive.

Tissue Specificity:

Expressed in activated monocytes/macrophages (at protein level).

Subunit Structure:

Monomer. In its precursor form, weakly interacts with full-length MEFV; the mature cytokine does not interact at all. Interacts with integrins ITGAV:ITGBV and ITGA5:ITGB1; integrin-binding is required for IL1B signaling.

Family&Domains:

Belongs to the IL-1 family.

Research Fields

· Cellular Processes > Cell growth and death > Necroptosis. (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway. (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Antifolate resistance.

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Endocrine and metabolic diseases > Type I diabetes mellitus.

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Neurodegenerative diseases > Prion diseases.

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Bacterial > Legionellosis.

· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.

· Human Diseases > Infectious diseases: Parasitic > Malaria.

· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Infectious diseases: Viral > Measles.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Human Diseases > Immune diseases > Graft-versus-host disease.

· Organismal Systems > Development > Osteoclast differentiation. (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway. (View pathway)

· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)

· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway. (View pathway)

· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway. (View pathway)

· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)

· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels. (View pathway)

References

1). Hypoxic acclimation improves cardiac redox homeostasis and protects heart against ischemia-reperfusion injury through upregulation of O-GlcNAcylation. Redox Biology (PubMed: 33964586) [IF=11.4]

Application: WB Species: rat Sample: heart

Fig. 3. | HA-induced inflammation stimulated protein O-GlcNAcylation in hearts. A, Immunoblot analysis of IL-1β and IL-6 in the Control and HA hearts (n = 9 per group).

2). Water-extracted Lonicera japonica polysaccharide attenuates allergic rhinitis by regulating NLRP3-IL-17 signaling axis. Carbohydrate Polymers (PubMed: 36184153) [IF=11.2]

3). DKK3 ameliorates neuropathic pain via inhibiting ASK-1/JNK/p-38-mediated microglia polarization and neuroinflammation. Journal of Neuroinflammation (PubMed: 35658977) [IF=9.3]

4). Mesenchymal stem cells protect against TBI-induced pyroptosis in vivo and in vitro through TSG-6. Cell Communication and Signaling (PubMed: 35982465) [IF=8.4]

5). Shen Shuai Ⅱ Recipe attenuates renal fibrosis in chronic kidney disease by improving hypoxia-induced the imbalance of mitochondrial dynamics via PGC-1α activation. PHYTOMEDICINE (PubMed: 35104767) [IF=7.9]

6). nNovel insights into antidepressant mechanism of Kai Xin San formula: inhibiting NLRP3 inflammasome activation by promoting autophagy. PHYTOMEDICINE (PubMed: 34735906) [IF=7.9]

7). Formononetin protects against inflammation associated with cerebral ischemia-reperfusion injury in rats by targeting the JAK2/STAT3 signaling pathway. BIOMEDICINE & PHARMACOTHERAPY (PubMed: 35339827) [IF=7.5]

8). Protective effects of Eleutheroside E against high-altitude pulmonary edema by inhibiting NLRP3 inflammasome-mediated pyroptosis. Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie (PubMed: 37776644) [IF=7.5]

9). Astragaloside IV alleviates PM2.5-caused lung toxicity by inhibiting inflammasome‐mediated pyroptosis via NLRP3/caspase-1 axis inhibition in mice. BIOMEDICINE & PHARMACOTHERAPY (PubMed: 35462332) [IF=7.5]

10). Pediococcus pentosaceus Enhances Host Resistance Against Pathogen by Increasing IL-1β Production: Understanding Probiotic Effectiveness and Administration Duration. Frontiers in Immunology (PubMed: 34899717) [IF=7.3]

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Cleaved-IL-1 beta (Asp116) Antibody - #AF4006