Phospho-Dab1 (Tyr220) Antibody - #AF2335
Product: | Phospho-Dab1 (Tyr220) Antibody |
Catalog: | AF2335 |
Description: | Rabbit polyclonal antibody to Phospho-Dab1 (Tyr220) |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 110 kDa; 64kD(Calculated). |
Uniprot: | O75553 |
RRID: | AB_2845349 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF2335, RRID:AB_2845349.
Fold/Unfold
Dab 1; Dab reelin signal transducer 1; Dab, reelin signal transducer, homolog 1 (Drosophila); Dab1; DAB1_HUMAN; Disabled homolog 1; Disabled homolog 1 Drosophila; Scm; Scr; Scrambler; Yot; Yotari;
Immunogens
- O75553 DAB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75553 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K43 | Ubiquitination | Uniprot | |
K45 | Ubiquitination | Uniprot | |
K84 | Sumoylation | Uniprot | |
Y198 | Phosphorylation | Uniprot | |
Y220 | Phosphorylation | Uniprot | |
Y232 | Phosphorylation | Uniprot | |
S433 | Phosphorylation | Uniprot | |
T506 | Phosphorylation | Uniprot | |
S524 | Phosphorylation | P24941 (CDK2) | Uniprot |
S526 | Phosphorylation | Uniprot | |
S548 | Phosphorylation | Uniprot |
Research Backgrounds
Adapter molecule functioning in neural development. May regulate SIAH1 activity.
Phosphorylated on Tyr-198 and Tyr-220 upon reelin induction in embryonic neurons. Also phosphorylated on Ser-524 independently of reelin signaling.
Mainly expressed in brain.
Associates with the SH2 domains of SRC, FYN and ABL (By similarity). Interacts (phosphorylated on tyrosine residues) with CRK and CRKL (via respective SH2 domain) (By similarity). Interacts with SIAH1, LRP8 and VLDLR (By similarity). Interacts with LRP1. Interacts with APLP1 (via NPXY motif) (By similarity). Interacts with DAB2IP (By similarity).
The PID domain specifically binds to the Asn-Pro-Xaa-Tyr(P) motif found in many tyrosine-phosphorylated proteins.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.