Phospho-CD79A (Tyr182) Antibody - #AF2329
| Product: | Phospho-CD79A (Tyr182) Antibody |
| Catalog: | AF2329 |
| Description: | Rabbit polyclonal antibody to Phospho-CD79A (Tyr182) |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Zebrafish, Bovine, Horse, Sheep, Dog, Xenopus |
| Mol.Wt.: | 45-55kDa; 25kD(Calculated). |
| Uniprot: | P11912 |
| RRID: | AB_2845343 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF2329, RRID:AB_2845343.
Fold/Unfold
B lymphocyte-specific MB1 protein; B-cell antigen receptor complex-associated protein alpha chain; CD 79a; CD79a; CD79a antigen (immunoglobulin-associated alpha); CD79A antigen; CD79a molecule, immunoglobulin-associated alpha; CD79A_HUMAN; Ig alpha; Ig-alpha; IGA; IgM-alpha; Immunoglobulin-associated alpha; Ly54; MB-1 membrane glycoprotein; MB1; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein;
Immunogens
- P11912 CD79A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P11912 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T140 | Phosphorylation | Uniprot | |
| K141 | Ubiquitination | Uniprot | |
| T161 | Phosphorylation | Uniprot | |
| K173 | Ubiquitination | Uniprot | |
| Y182 | Phosphorylation | Uniprot | |
| Y188 | Phosphorylation | P51451 (BLK) , P07948 (LYN) | Uniprot |
| S197 | Phosphorylation | P43405 (SYK) | Uniprot |
| Y199 | Phosphorylation | P51451 (BLK) , P06241 (FYN) | Uniprot |
| S203 | Phosphorylation | P43405 (SYK) | Uniprot |
| T209 | Phosphorylation | Uniprot | |
| Y210 | Phosphorylation | Uniprot | |
| S215 | Phosphorylation | Uniprot | |
| K225 | Ubiquitination | Uniprot |
Research Backgrounds
Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.
Phosphorylated on tyrosine, serine and threonine residues upon B-cell activation. Phosphorylation of tyrosine residues by Src-family kinases is an early and essential feature of the BCR signaling cascade. The phosphorylated tyrosines serve as docking sites for SH2-domain containing kinases, leading to their activation which in turn leads to phosphorylation of downstream targets. Phosphorylated by LYN. Phosphorylation of serine and threonine residues may prevent subsequent tyrosine phosphorylation.
Arginine methylation in the ITAM domain may interfere with the binding of SYK. It promotes signals leading to B-cell differentiation (By similarity).
Cell membrane>Single-pass type I membrane protein.
Note: Following antigen binding, the BCR has been shown to translocate from detergent-soluble regions of the cell membrane to lipid rafts although signal transduction through the complex can also occur outside lipid rafts.
B-cells.
Heterodimer of alpha and beta chains; disulfide-linked. Part of the B-cell antigen receptor complex where the alpha/beta chain heterodimer is non-covalently associated with an antigen-specific membrane-bound surface immunoglobulin of two heavy chains and two light chains. Interacts through its phosphorylated ITAM domain with the SH2 domains of SYK which stimulates SYK autophosphorylation and activation. Also interacts, when phosphorylated on Tyr-210, with the SH2 domain of BLNK/SLP65, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK which is necessary for trafficking of the BCR to late endosomes. Interacts with Src-family tyrosine kinases including FYN and LYN, increasing their activity (By similarity).
Research Fields
· Human Diseases > Immune diseases > Primary immunodeficiency.
· Organismal Systems > Immune system > B cell receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.