Mast Cell Chymase Antibody - #DF12290
Product: | Mast Cell Chymase Antibody |
Catalog: | DF12290 |
Description: | Rabbit polyclonal antibody to Mast Cell Chymase |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Dog |
Mol.Wt.: | 27-30 kDa; 27kD(Calculated). |
Uniprot: | P23946 |
RRID: | AB_2845095 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12290, RRID:AB_2845095.
Fold/Unfold
Alpha-chymase; Chymase 1; Chymase 1 mast cell; chymase 1 preproprotein transcript E; chymase 1 preproprotein transcript I; Chymase; Chymase, heart; Chymase, mast cell; CMA1; CMA1_HUMAN; CYH; CYM; EC 3.4.21.39; Mast cell chymase 1; Mast cell protease 3; Mast cell protease 5; Mast cell protease I; Mast cell protease III; Mcp-5; MCP3P; Mcpt5; MCT1; MGC119890; MGC119891; MMCP-5;
Immunogens
Mast cells in lung, heart, skin and placenta. Expressed in both normal skin and in urticaria pigmentosa lesions.
- P23946 CMA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P23946 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S15 | Phosphorylation | Uniprot | |
Y35 | Phosphorylation | Uniprot | |
Y38 | Phosphorylation | Uniprot | |
N80 | N-Glycosylation | Uniprot | |
N103 | N-Glycosylation | Uniprot |
Research Backgrounds
Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
Secreted. Cytoplasmic granule.
Note: Mast cell granules.
Mast cells in lung, heart, skin and placenta. Expressed in both normal skin and in urticaria pigmentosa lesions.
Belongs to the peptidase S1 family. Granzyme subfamily.
Research Fields
· Organismal Systems > Endocrine system > Renin-angiotensin system. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.