Product: OCT3 Antibody
Catalog: AF0226
Description: Rabbit polyclonal antibody to OCT3
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Rabbit, Dog
Mol.Wt.: 50kDa; 39kD(Calculated).
Uniprot: Q01860
RRID: AB_2833401

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
OCT3 Antibody detects endogenous levels of total OCT3.
RRID:
AB_2833401
Cite Format: Affinity Biosciences Cat# AF0226, RRID:AB_2833401.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Octamer binding transcription factor 4; MGC22487; Oct 3; Oct 4; Oct-3; Oct-4; OCT3; Oct4; Octamer binding protein 3; Octamer binding protein 4; Octamer binding transcription factor 3; Octamer-binding protein 3; Octamer-binding protein 4; Octamer-binding transcription factor 3; OTF 3; OTF 4; OTF-3; OTF3; OTF4; PO5F1_HUMAN; POU class 5 homeobox 1; POU domain class 5 transcription factor 1; POU domain transcription factor OCT4; POU domain, class 5, transcription factor 1; POU-type homeodomain-containing DNA-binding protein; POU5F1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q01860 PO5F1_HUMAN:

Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues.

Description:
Oct4 Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency. Belongs to the POU transcription factor family. Class- 5 subfamily.
Sequence:
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Dog
100
Rabbit
100
Horse
0
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q01860 As Substrate

Site PTM Type Enzyme
S12 Phosphorylation
T92 Phosphorylation
S93 Phosphorylation
S105 Phosphorylation
S107 Phosphorylation
S111 Phosphorylation P27361 (MAPK3) , P28482 (MAPK1)
T116 Phosphorylation
T118 Phosphorylation P28482 (MAPK1)
K123 Sumoylation
K140 Methylation
K140 Ubiquitination
K144 Acetylation
K144 Methylation
K151 Acetylation
K151 Methylation
K151 Ubiquitination
K154 Acetylation
K154 Methylation
K154 Ubiquitination
K156 Acetylation
K156 Methylation
K156 Ubiquitination
T163 Phosphorylation
K177 Methylation
S180 Phosphorylation
R186 Methylation
S193 Phosphorylation
K195 Acetylation
K195 Methylation
K195 Ubiquitination
K199 Acetylation
K199 Methylation
K206 Methylation
K206 Ubiquitination
T235 Phosphorylation P31751 (AKT2) , P31749 (AKT1) , Q9Y243 (AKT3)
S236 Phosphorylation
S288 Phosphorylation P11309 (PIM1) , P17612 (PRKACA)
S289 Phosphorylation P11309 (PIM1) , P17612 (PRKACA)
S290 Phosphorylation
Y292 Phosphorylation
T352 Phosphorylation
S355 Phosphorylation P28482 (MAPK1)
S359 Phosphorylation

Research Backgrounds

Function:

Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 or SOX15 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.

PTMs:

Sumoylation enhances the protein stability, DNA binding and transactivation activity. Sumoylation is required for enhanced YES1 expression.

Ubiquitinated; undergoes 'Lys-63'-linked polyubiquitination by WWP2 leading to proteasomal degradation.

ERK1/2-mediated phosphorylation at Ser-111 promotes nuclear exclusion and proteasomal degradation. Phosphorylation at Thr-235 and Ser-236 decrease DNA-binding and alters ability to activate transcription.

Subcellular Location:

Cytoplasm. Nucleus.
Note: Expressed in a diffuse and slightly punctuate pattern. Colocalizes with MAPK8 and MAPK9 in the nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues.

Subunit Structure:

Interacts with PKM. Interacts with WWP2. Interacts with UBE2I and ZSCAN10 (By similarity). Interacts with PCGF1. Interacts with ESRRB; recruits ESRRB near the POU5F1-SOX2 element in the NANOG proximal promoter; the interaction is DNA independent (By similarity). Interacts with ZNF322 (By similarity). Interacts with MAPK8 and MAPK9; the interaction allows MAPK8 and MAPK9 to phosphorylate POU5F1 on Ser-355 (By similarity). Interacts (when phosphorylated on Ser-355) with FBXW8 (By similarity). Interacts with FBXW4 (By similarity). Interacts with SOX2 and SOX15; binds synergistically with either SOX2 or SOX15 to DNA (By similarity).

Family&Domains:

The POU-specific domain mediates interaction with PKM.

Belongs to the POU transcription factor family. Class-5 subfamily.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells.   (View pathway)

References

1). Ginsenoside Rg2 Promotes the Proliferation and Stemness Maintenance of Porcine Mesenchymal Stem Cells through Autophagy Induction. Foods, 2023 (PubMed: 36900592) [IF=5.2]

Application: WB    Species: porcine    Sample: pMSCs

Figure 2. Reduced proliferation potential and stemness of pMSCs after long-time culture. (A) SA–β–gal staining of pMSCs at P5, P10, and P15. SA–β–gal–positive cells were indicated by red arrows. Scale bar = 10 μm. (B) Quantification of the SA–β–gal staining in (A). (C) EdU staining of pMSCs at P5, P10, and P15. Scale bar = 200 μm. (D) Quantification of the EdU staining in (C). (E) qRT–PCR analysis of KI67 in pMSCs at P5, P10, and P15. (F) qRT–PCR analysis of OCT4 in pMSCs at P5, P10, and P15. (G) Western blot analysis with anti–OCT4 and anti-P53 antibodies in pMSCs at P5, P10, and P15. (H) Quantification of OCT4 expression levels in (G). (I) Quantification of P53 expression levels in (G).

2). The adenosine-A2a receptor regulates the radioresistance of gastric cancer via PI3K-AKT-mTOR pathway. International Journal of Clinical Oncology, 2022 (PubMed: 35122587) [IF=3.3]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.