Product: Phospho-PRPS1 (Ser180) Antibody
Catalog: AF8611
Source: Rabbit
Application: WB, IHC, ELISA(peptide)
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 34 kD; 35kD(Calculated).
Uniprot: P60891
RRID: AB_2843462

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
Phospho-PRPS1 (Ser180) Antibody detects endogenous levels of PRPS1 only when phosphorylated at S180.
RRID:
AB_2843462
Cite Format: Affinity Biosciences Cat# AF8611, RRID:AB_2843462.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ARTS; CMTX5; Deafness 2 perceptive congenital; Deafness X linked 2 perceptive congenital; DFN2; DFNX1; EC 2.7.6.1; KIAA0967; Phosphoribosyl pyrophosphate synthase I; Phosphoribosyl pyrophosphate synthetase I; PPRibP; Prps1; PRPS1_HUMAN; PRS I; PRS-I; PRSI; Ribose phosphate pyrophosphokinase I; Ribose-phosphate pyrophosphokinase 1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis.
Sequence:
MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Chicken
100
Rabbit
100
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P60891 As Substrate

Site PTM Type Enzyme
K5 Ubiquitination
K18 Ubiquitination
R22 Methylation
K29 Ubiquitination
S36 Phosphorylation
S103 Phosphorylation
Y146 Phosphorylation
R156 Methylation
K176 Acetylation
K176 Ubiquitination
S180 Phosphorylation
R184 Methylation
K194 Acetylation
K194 Ubiquitination
R204 Methylation
K212 Acetylation
K212 Ubiquitination
T225 Phosphorylation
T228 Phosphorylation
K235 Ubiquitination
S238 Phosphorylation
T242 Phosphorylation
Y245 Phosphorylation
K280 Ubiquitination
S308 Phosphorylation
S310 Phosphorylation
Y311 Phosphorylation

Research Backgrounds

Function:

Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis.

Subunit Structure:

Homodimer. The active form is probably a hexamer composed of 3 homodimers.

Family&Domains:

Belongs to the ribose-phosphate pyrophosphokinase family.

Research Fields

· Metabolism > Carbohydrate metabolism > Pentose phosphate pathway.

· Metabolism > Nucleotide metabolism > Purine metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Metabolism > Global and overview maps > Carbon metabolism.

· Metabolism > Global and overview maps > Biosynthesis of amino acids.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.