USP12 Antibody - #DF9981
| Product: | USP12 Antibody |
| Catalog: | DF9981 |
| Description: | Rabbit polyclonal antibody to USP12 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Rabbit, Dog, Chicken |
| Mol.Wt.: | 43 kDa; 43kD(Calculated). |
| Uniprot: | O75317 |
| RRID: | AB_2843173 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9981, RRID:AB_2843173.
Fold/Unfold
Deubiquitinating enzyme 12; OTTHUMP00000042337; UBH 1; UBH1; Ubiquitin carboxyl terminal hydrolase 12; Ubiquitin carboxyl-terminal hydrolase 12; Ubiquitin hydrolyzing enzyme 1; Ubiquitin specific peptidase 12; Ubiquitin specific processing protease 12; Ubiquitin specific protease 12 like 1; Ubiquitin thioesterase 12; Ubiquitin thiolesterase 12; Ubiquitin-hydrolyzing enzyme 1; Ubiquitin-specific-processing protease 12; UBP12_HUMAN; USP 12; Usp12; USP12L1;
Immunogens
- O75317 UBP12_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTPDPTWVHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSRD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75317 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y264 | Phosphorylation | Uniprot | |
| Y271 | Phosphorylation | Uniprot | |
| K273 | Ubiquitination | Uniprot |
Research Backgrounds
Deubiquitinating enzyme. Has almost no deubiquitinating activity by itself and requires the interaction with WDR20 and WDR48 to have a high activity. Not involved in deubiquitination of monoubiquitinated FANCD2. In complex with WDR48, acts as a potential tumor suppressor by positively regulating PHLPP1 stability.
Interacts with WDR48. Interacts with WDR20. Component of the USP12/WDR20/WDR48 deubiquitinating complex. Interacts with PHLPP1.
Belongs to the peptidase C19 family. USP12/USP46 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.