TRAPPC1 Antibody - #DF9964
| Product: | TRAPPC1 Antibody |
| Catalog: | DF9964 |
| Description: | Rabbit polyclonal antibody to TRAPPC1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat, Monkey |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 17 kDa; 17kD(Calculated). |
| Uniprot: | Q9Y5R8 |
| RRID: | AB_2843158 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9964, RRID:AB_2843158.
Fold/Unfold
BET5; BET5 homolog; Melanoma ubiquitous mutated 2; Multiple myeloma protein 2; MUM 2; MUM-2; MUM2; TPPC1_HUMAN; Trafficking protein particle complex 1; Trafficking protein particle complex subunit 1; TRAPPC 1; Trappc1;
Immunogens
- Q9Y5R8 TPPC1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y5R8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K25 | Acetylation | Uniprot | |
| K31 | Acetylation | Uniprot | |
| Y39 | Phosphorylation | Uniprot | |
| K51 | Ubiquitination | Uniprot | |
| K58 | Ubiquitination | Uniprot | |
| K70 | Ubiquitination | Uniprot | |
| Y73 | Phosphorylation | Uniprot | |
| T86 | Phosphorylation | Uniprot | |
| R129 | Methylation | Uniprot | |
| S132 | Phosphorylation | Uniprot | |
| Y133 | Phosphorylation | Uniprot | |
| S141 | Phosphorylation | Uniprot |
Research Backgrounds
May play a role in vesicular transport from endoplasmic reticulum to Golgi.
Golgi apparatus>cis-Golgi network. Endoplasmic reticulum.
Part of the multisubunit transport protein particle (TRAPP) complex. The heterodimer TRAPPC6B-TRAPPC3 interacts with TRAPPC1 likely providing a core for TRAPP complex formation.
Belongs to the TRAPP small subunits family. BET5 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.