SLC10A4 Antibody - #DF9931
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9931, RRID:AB_2843125.
Fold/Unfold
Bile acid transporter SLC10A4; MGC29802; Na(+)/bile acid cotransporter 4; NTCP4_HUMAN; P4; Slc10a4; Sodium/bile acid cotransporter 4; Solute carrier family 10 (sodium/bile acid cotransporter family) member 4; Solute carrier family 10 member 4;
Immunogens
Highly expressed in brain and small intestine, and moderately expressed in colon, heart, prostate, and testis. Very low levels were detected in kidney, liver, ovary, placenta, spleen, and thymus.
- Q96EP9 NTCP4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDGNDNVTLLFAPLLRDNYTLAPNASSLGPGTDLALAPASSAGPGPGLSLGPGPSFGFSPGPTPTPEPTTSGLAGGAASHGPSPFPRPWAPHALPFWDTPLNHGLNVFVGAALCITMLGLGCTVDVNHFGAHVRRPVGALLAALCQFGLLPLLAFLLALAFKLDEVAAVAVLLCGCCPGGNLSNLMSLLVDGDMNLSIIMTISSTLLALVLMPLCLWIYSWAWINTPIVQLLPLGTVTLTLCSTLIPIGLGVFIRYKYSRVADYIVKVSLWSLLVTLVVLFIMTGTMLGPELLASIPAAVYVIAIFMPLAGYASGYGLATLFHLPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYGTVKAENIIMMETAQTSL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96EP9 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y406 | Phosphorylation | Uniprot | |
| K407 | Ubiquitination | Uniprot | |
| K410 | Ubiquitination | Uniprot | |
| T417 | Phosphorylation | Uniprot | |
| S418 | Phosphorylation | Uniprot | |
| Y419 | Phosphorylation | Uniprot | |
| T421 | Phosphorylation | Uniprot |
Research Backgrounds
Transporter for bile acids.
Activated following N-terminal proteolytic cleavage by thrombin and/or proteases.
Cell membrane>Multi-pass membrane protein.
Highly expressed in brain and small intestine, and moderately expressed in colon, heart, prostate, and testis. Very low levels were detected in kidney, liver, ovary, placenta, spleen, and thymus.
Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.