SLC6A18 Antibody - #DF9925
| Product: | SLC6A18 Antibody |
| Catalog: | DF9925 |
| Description: | Rabbit polyclonal antibody to SLC6A18 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 71 kDa; 71kD(Calculated). |
| Uniprot: | Q96N87 |
| RRID: | AB_2843119 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9925, RRID:AB_2843119.
Fold/Unfold
FLJ31236; Sodium and chloride dependent transporter XTRP2; Sodium channel like protein; Sodium dependent neutral amino acid transporter B(0)AT3; Solute carrier family 6 (neurotransmitter transporter) member 18; Solute carrier family 6 (neutral amino acid transporter), member 18; Solute carrier family 6 member 18; System B(0) neutral amino acid transporter AT3; Xtrp 2; Xtrp2;
Immunogens
- Q96N87 S6A18_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAHAPEPDPAACDLGDERPKWDNKAQYLLSCTGFAVGLGNIWRFPYLCQTYGGGAFLIPYVIALVFEGIPIFHVELAIGQRLRKGSVGVWTAISPYLSGVGLGCVTLSFLISLYYNTIVAWVLWYLLNSFQHPLPWSSCPPDLNRTGFVEECQGSSAVSYFWYRQTLNITADINDSGSIQWWLLICLAASWAVVYMCVIRGIETTGKVIYFTALFPYLVLTIFLIRGLTLPGATKGLIYLFTPNMHILQNPRVWLDAATQIFFSLSLAFGGHIAFASYNSPRNDCQKDAVVIALVNRMTSLYASIAVFSVLGFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAPVWAMLFFGMLFTLGLSTMFGTVEAVITPLLDVGVLPRWVPKEALTGLVCLVCFLSATCFTLQSGNYWLEIFDNFAASPNLLMLAFLEVVGVVYVYGMKRFCDDIAWMTGRRPSPYWRLTWRVVSPLLLTIFVAYIILLFWKPLRYKAWNPKYELFPSRQEKLYPGWARAACVLLSLLPVLWVPVAALAQLLTRRRRTWRDRDARPDTDMRPDTDTRPDTDMRPDTDMR
PTMs - Q96N87 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T412 | Phosphorylation | Uniprot | |
| S416 | Phosphorylation | Uniprot | |
| Y552 | Phosphorylation | Uniprot | |
| T592 | Phosphorylation | Uniprot |
Research Backgrounds
Does not show neutral amino acid transporter activity.
Membrane>Multi-pass membrane protein.
Abundantly expressed in kidney, but not in intestine.
Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A18 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.