SLC6A12 Antibody - #DF9921
| Product: | SLC6A12 Antibody |
| Catalog: | DF9921 |
| Description: | Rabbit polyclonal antibody to SLC6A12 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 69kDa; 69kD(Calculated). |
| Uniprot: | P48065 |
| RRID: | AB_2843115 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9921, RRID:AB_2843115.
Fold/Unfold
Betaine/GABA transporter 1; BGT-1; BGT1; Gamma aminobutyric acid transporter; GAT2; Na(+)/Cl(-) betaine/GABA transporter; S6A12_HUMAN; Slc6a12; Sodium- and chloride-dependent betaine transporter; Solute carrier family 6 (neurotransmitter transporter), member 12; Solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12; Solute carrier family 6 member 12;
Immunogens
Liver, heart, skeletal muscle, placenta, and a widespread distribution in the brain.
- P48065 S6A12_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDGKVAVQECGPPAVSWVPEEGEKLDQEDEDQVKDRGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFIFFFVCGIPVFFLEVALGQYTSQGSVTAWRKICPLFQGIGLASVVIESYLNVYYIIILAWALFYLFSSFTSELPWTTCNNFWNTEHCTDFLNHSGAGTVTPFENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKDPQVWMDAGTQIFFSFAICQGCLTALGSYNKYHNNCYKDCIALCFLNSATSFVAGFVVFSILGFMSQEQGVPISEVAESGPGLAFIAFPKAVTMMPLSQLWSCLFFIMLIFLGLDSQFVCVECLVTASIDMFPRQLRKSGRRELLILTIAVMCYLIGLFLVTEGGMYIFQLFDYYASSGICLLFLSLFEVVCISWVYGADRFYDNIEDMIGYRPWPLVKISWLFLTPGLCLATFLFSLSKYTPLKYNNVYVYPPWGYSIGWFLALSSMVCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL
PTMs - P48065 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K24 | Ubiquitination | Uniprot | |
| K610 | Ubiquitination | Uniprot |
Research Backgrounds
Transports betaine and GABA. May have a role in regulation of GABAergic transmission in the brain through the reuptake of GABA into presynaptic terminals, as well as in osmotic regulation.
Membrane>Multi-pass membrane protein.
Liver, heart, skeletal muscle, placenta, and a widespread distribution in the brain.
Interacts with LIN7C.
Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A12 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.