VRK1 Antibody - #DF9892
| Product: | VRK1 Antibody |
| Catalog: | DF9892 |
| Description: | Rabbit polyclonal antibody to VRK1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
| Mol.Wt.: | 45 kDa; 45kD(Calculated). |
| Uniprot: | Q99986 |
| RRID: | AB_2843086 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9892, RRID:AB_2843086.
Fold/Unfold
MGC117401; MGC138280; MGC142070; PCH1; PCH1A; Serine/threonine protein kinase VRK1; Serine/threonine-protein kinase VRK1; Vaccinia related kinase 1; Vaccinia virus B1R related kinase 1; Vaccinia-related kinase 1; VRK1; VRK1_HUMAN;
Immunogens
- Q99986 VRK1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99986 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K5 | Methylation | Uniprot | |
| K5 | Sumoylation | Uniprot | |
| K5 | Ubiquitination | Uniprot | |
| K16 | Ubiquitination | Uniprot | |
| K34 | Ubiquitination | Uniprot | |
| K71 | Ubiquitination | Uniprot | |
| S75 | Phosphorylation | Uniprot | |
| K85 | Ubiquitination | Uniprot | |
| K92 | Sumoylation | Uniprot | |
| K92 | Ubiquitination | Uniprot | |
| K98 | Acetylation | Uniprot | |
| K98 | Ubiquitination | Uniprot | |
| K106 | Ubiquitination | Uniprot | |
| K112 | Sumoylation | Uniprot | |
| K112 | Ubiquitination | Uniprot | |
| K121 | Ubiquitination | Uniprot | |
| K140 | Acetylation | Uniprot | |
| K140 | Ubiquitination | Uniprot | |
| K147 | Acetylation | Uniprot | |
| K147 | Ubiquitination | Uniprot | |
| K152 | Sumoylation | Uniprot | |
| K152 | Ubiquitination | Uniprot | |
| T153 | Phosphorylation | Uniprot | |
| S158 | Phosphorylation | Uniprot | |
| K188 | Ubiquitination | Uniprot | |
| K211 | Acetylation | Uniprot | |
| K211 | Ubiquitination | Uniprot | |
| K269 | Sumoylation | Uniprot | |
| K269 | Ubiquitination | Uniprot | |
| K275 | Sumoylation | Uniprot | |
| K288 | Ubiquitination | Uniprot | |
| K293 | Acetylation | Uniprot | |
| K301 | Ubiquitination | Uniprot | |
| T305 | Phosphorylation | Uniprot | |
| K307 | Sumoylation | Uniprot | |
| K307 | Ubiquitination | Uniprot | |
| K314 | Ubiquitination | Uniprot | |
| K329 | Ubiquitination | Uniprot | |
| K334 | Acetylation | Uniprot | |
| K338 | Sumoylation | Uniprot | |
| K338 | Ubiquitination | Uniprot | |
| S342 | Phosphorylation | Q9H4B4 (PLK3) | Uniprot |
| K350 | Sumoylation | Uniprot | |
| T355 | Phosphorylation | Q05655 (PRKCD) , Q99986 (VRK1) | Uniprot |
| S376 | Phosphorylation | Uniprot | |
| T378 | Phosphorylation | Uniprot | |
| T380 | Phosphorylation | Uniprot | |
| T390 | Phosphorylation | Uniprot |
PTMs - Q99986 As Enzyme
| Substrate | Site | Source |
|---|---|---|
| O60934 (NBN) | S343 | Uniprot |
| O75531 (BANF1) | T2 | Uniprot |
| O75531 (BANF1) | T3 | Uniprot |
| O75531 (BANF1) | S4 | Uniprot |
| P04637 (TP53) | T18 | Uniprot |
| P05412 (JUN) | S63 | Uniprot |
| P05412 (JUN) | S73 | Uniprot |
| P15336 (ATF2) | S62 | Uniprot |
| P15336 (ATF2) | T73 | Uniprot |
| P16220 (CREB1) | S133 | Uniprot |
| P38432 (COIL) | S184 | Uniprot |
| P68431 (HIST1H3J) | T4 | Uniprot |
| P68431 (HIST1H3J) | S11 | Uniprot |
| Q99986 (VRK1) | T355 | Uniprot |
Research Backgrounds
Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity.
Autophosphorylated at various serine and threonine residues. Autophosphorylation does not impair its ability to phosphorylate p53/TP53. Phosphorylation by PLK3 leads to induction of Golgi fragmentation during mitosis.
Cytoplasm. Nucleus. Cytoplasm>Cytoskeleton>Spindle.
Note: Dispersed throughout the cell but not located on mitotic spindle or chromatids during mitosis.
Widely expressed. Highly expressed in fetal liver, testis and thymus.
Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. VRK subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.